UniProt UniProt http://www.uniprot.org vayssiere-2000-3 Interaction of the Grb7 adapter protein with Rnd1, a new member of the Rho family. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Vayssiere B., Zalcman G., Mahe Y., Mirey G., Ligensa T., Weidner KM., Chardin P., Camonis J. 9.5 day mouse embryo cDNA FEBS Lett. (0014-5793) 2000 Only protein-protein interactions imex curation vayssiere-2000-1 Interaction of the Grb7 adapter protein with Rnd1, a new member of the Rho family. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Vayssiere B., Zalcman G., Mahe Y., Mirey G., Ligensa T., Weidner KM., Chardin P., Camonis J. 9.5 day mouse embryo cDNA FEBS Lett. (0014-5793) 2000 Only protein-protein interactions imex curation vayssiere-2000-2 Interaction of the Grb7 adapter protein with Rnd1, a new member of the Rho family. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Vayssiere B., Zalcman G., Mahe Y., Mirey G., Ligensa T., Weidner KM., Chardin P., Camonis J. 9.5 day mouse embryo cDNA FEBS Lett. (0014-5793) 2000 Only protein-protein interactions imex curation vayssiere-2000-4 Interaction of the Grb7 adapter protein with Rnd1, a new member of the Rho family. human-skbr3 Homo sapiens SKBR3 skbr3 SKBR3 Species: human; Tissue: breast; Tumor: adenocarcinoma; Derived from: metastatic site: pleural effusion anti bait coip anti bait coimmunoprecipitation anti bait coip antibody detection identification by antibody antibody detection Vayssiere B., Zalcman G., Mahe Y., Mirey G., Ligensa T., Weidner KM., Chardin P., Camonis J. Due to a lack of endogenous RND1 or overexpressed RND1, SK-BR3 cell extracts has been incubated with polyclonal anti-RND1 antibodies in the presence of bacterially expresed RND1. 9.5 day mouse embryo cDNA FEBS Lett. (0014-5793) 2000 Only protein-protein interactions imex curation grb7_human Growth factor receptor-bound protein 7 GRB7 GRB7 adapter protein Epidermal growth factor receptor GRB-7 B47 protein protein human Homo sapiens Human MELDLSPPHLSSSPEDLCPAPGTPPGTPRPPDTPLPEEVKRSQPLLIPTTGRKLREEERRATSLPSIPNPFPELCSPPSQSPILGGPSSARGLLPRDASRPHVVKVYSEDGACRSVEVAAGATARHVCEMLVQRAHALSDETWGLVECHPHLALERGLEDHESVVEVQAAWPVGGDSRFVFRKNFAKYELFKSSPHSLFPEKMVSSCLDAHTGISHEDLIQNFLNAGSFPEIQGFLQLRGSGRKLWKRFFCFLRRSGLYYSTKGTSKDPRHLQYVADVNESNVYVVTQGRKLYGMPTDFGFCVKPNKLRNGHKGLRIFCSEDEQSRTCWLAAFRLFKYGVQLYKNYQQAQSRHLHPSCLGSPPLRSASDNTLVAMDFSGHAGRVIENPREALSVALEEAQAWRKKTNHRLSLPMPASGTSLSAAIHRTQLWFHGRISREESQRLIGQQGLVDGLFLVRESQRNPQGFVLSLCHLQKVKHYLILPSEEEGRLYFSMDDGQTRFTDLLQLVEFHQLNRGILPCLLRHCCTRVAL rnd1_human Rho-related GTP-binding protein Rho6 RND1 RHO6 Rho family GTPase 1 Rnd1 protein protein human Homo sapiens Human MKERRAPQPVVARCKLVLVGDVQCGKTAMLQVLAKDCYPETYVPTVFENYTACLETEEQRVELSLWDTSGSPYYDNVRPLCYSDSDAVLLCFDISRPETVDSALKKWRTEILDYCPSTRVLLIGCKTDLRTDLSTLMELSHQKQAPISYEQGCAIAKQLGAEIYLEGSAFTSEKSIHSIFRTASMLCLNKPSPLPQKSPVRSLSKRLLHLPSRSELISSTFKKEKAKSCSIM rnd1_mouse Rho-related GTP-binding protein Rho6 Rnd1 Rho6 Rho family GTPase 1 Rnd1 protein protein mouse Mus musculus Mouse MKERRAPQPVVVRCKLVLVGDVQCGKTAMLQVLAKDCYPETYVPTVFENYTACLETEEQRVELSLWDTSGSPYYDNVRPLCYSDSDAVLLCFDISRPETMDSALKKWRTEILDYCPSTRVLLIGCKTDLRTDLSTLMELSHQKQAPISYEQGCAIAKQLGAEIYLEGSAFTSETSIHSIFRTASMVCLNKSSPVPPKSPVRSLSKRLLHLPSRSELISTTFKKEKAKSCSIM grb7-rnd1-1 762051 n/a 762055 unspecified role unspecified role bait bait sh2 domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 762056 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) physical association physical association false false false figure 2 grb7-rnd1-2 762051 n/a-x-x-x 762055 unspecified role unspecified role bait bait sh2 domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A-x-x 762056 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association false false false figure 3 and 4 The interaction does not require RND1 tyrosine phosphorylation. grb7-rnd1 762052 N/A 762057 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false n/a 762055 unspecified role unspecified role bait bait physical association physical association false false false no figure The species origin for GRB7 could not be umambiguously deduced from the publication. Authors refer to Keegan K. (1996) (PMID: 8622870). rnd1-grb7 762053 N/A 762056 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 762055 unspecified role unspecified role prey prey sh2 domian binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false figure 1 rnd1-grb7-1 762054 n/a 762055 unspecified role unspecified role prey prey N/A 762056 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) physical association physical association false false false 5