IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ zhou-2000a-2 NPR1 differentially interacts with members of the TGA/OBF family of transcription factors that bind an element of the PR-1 gene required for induction by salicylic acid. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhou JM., Trifa Y., Silva H., Pontier D., Lam E., Shah J., Klessig DF. klessig@mbcl.rutgers.edu A cDNA library generated from Arabidopsis thaliana ecotype Columbia. Mol. Plant Microbe Interact. (0894-0282) 2000 Only protein-protein interactions imex curation zhou-2000a-1 NPR1 differentially interacts with members of the TGA/OBF family of transcription factors that bind an element of the PR-1 gene required for induction by salicylic acid. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Zhou JM., Trifa Y., Silva H., Pontier D., Lam E., Shah J., Klessig DF. klessig@mbcl.rutgers.edu A cDNA library generated from Arabidopsis thaliana ecotype Columbia. Mol. Plant Microbe Interact. (0894-0282) 2000 Only protein-protein interactions imex curation zhou-2000a-3 NPR1 differentially interacts with members of the TGA/OBF family of transcription factors that bind an element of the PR-1 gene required for induction by salicylic acid. in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Zhou JM., Trifa Y., Silva H., Pontier D., Lam E., Shah J., Klessig DF. klessig@mbcl.rutgers.edu A cDNA library generated from Arabidopsis thaliana ecotype Columbia. Mol. Plant Microbe Interact. (0894-0282) 2000 Only protein-protein interactions imex curation npr1_arath Regulatory protein NPR1 SAI1 BTB/POZ domain-containing protein NPR1 NPR1 NIM1 At1g64280 F15H21.6 Nonexpresser of PR genes 1 Non-inducible immunity protein 1 Salicylic acid insensitive 1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDTTIDGFADSYEISSTSFVATDNTDSSIVYLAAEQVLTGPDVSALQLLSNSFESVFDSPDDFYSDAKLVLSDGREVSFHRCVLSARSSFFKSALAAAKKEKDSNNTAAVKLELKEIAKDYEVGFDSVVTVLAYVYSSRVRPPPKGVSECADENCCHVACRPAVDFMLEVLYLAFIFKIPELITLYQRHLLDVVDKVVIEDTLVILKLANICGKACMKLLDRCKEIIVKSNVDMVSLEKSLPEELVKEIIDRRKELGLEVPKVKKHVSNVHKALDSDDIELVKLLLKEDHTNLDDACALHFAVAYCNVKTATDLLKLDLADVNHRNPRGYTVLHVAAMRKEPQLILSLLEKGASASEATLEGRTALMIAKQATMAVECNNIPEQCKHSLKGRLCVEILEQEDKREQIPRDVPPSFAVAADELKMTLLDLENRVALAQRLFPTEAQAAMEIAEMKGTCEFIVTSLEPDRLTGTKRTSPGVKIAPFRILEEHQSRLKALSKTVELGKRFFPRCSAVLDQIMNCEDLTQLACGEDDTAEKRLQKKQRYMEIQETLKKAFSEDNLELGNSSLTDSTSSTSKSTGGKRSNRKLSHRRR tga1_arath Transcription factor TGA1 DNA-binding protein TGA1a-like protein TGA1 BZIP47 At5g65210 MQN23.15 bZIP transcription factor 47 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNSTSTHFVPPRRVGIYEPVHQFGMWGESFKSNISNGTMNTPNHIIIPNNQKLDNNVSEDTSHGTAGTPHMFDQEASTSRHPDKIQRRLAQNREAARKSRLRKKAYVQQLETSRLKLIQLEQELDRARQQGFYVGNGIDTNSLGFSETMNPGIAAFEMEYGHWVEEQNRQICELRTVLHGHINDIELRSLVENAMKHYFELFRMKSSAAKADVFFVMSGMWRTSAERFFLWIGGFRPSDLLKVLLPHFDVLTDQQLLDVCNLKQSCQQAEDALTQGMEKLQHTLADCVAAGQLGEGSYIPQVNSAMDRLEALVSFVNQADHLRHETLQQMYRILTTRQAARGLLALGEYFQRLRALSSSWATRHREPT tga5_arath Transcription factor TGA5 TGA5 BZIP26 OBF5 At5g06960 MOJ9.13 Ocs element-binding factor 5 bZIP transcription factor 26 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGDTSPRTSVSTDGDTDHNNLMFDEGHLGIGASDSSDRSKSKMDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFISSSGDQAHSTAGDGAMAFDVEYRRWQEDKNRQMKELSSAIDSHATDSELRIIVDGVIAHYEELYRIKGNAAKSDVFHLLSGMWKTPAERCFLWLGGFRSSELLKLIASQLEPLTEQQSLDINNLQQSSQQAEDALSQGMDNLQQSLADTLSSGTLGSSSSGNVASYMGQMAMAMGKLGTLEGFIRQADNLRLQTYQQMVRLLTTRQSARALLAVHNYTLRLRALSSLWLARPRE tga6_arath Transcription factor TGA6 TGA6 BZIP45 At3g12250 F28J15.6 MQC3.8 bZIP transcription factor 45 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADTSSRTDVSTDGDTDHRDLGSDRGHMHAAASDSSDRSKDKLDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFISSSGDQAHSTGGNGALAFDAEHSRWLEEKNRQMNELRSALNAHAGDTELRIIVDGVMAHYEELFRIKSNAAKNDVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLANQLEPMTERQVMGINSLQQTSQQAEDALSQGMESLQQSLADTLSSGTLGSSSSDNVASYMGQMAMAMGQLGTLEGFIRQADNLRLQTLQQMLRVLTTRQSARALLAIHDYSSRLRALSSLWLARPRE tga4_arath Transcription factor TGA4 Ocs element-binding factor 4 TGA4 BZIP57 OBF4 At5g10030 T31P16_20 bZIP transcription factor 57 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNTTSTHFVPPRRFEVYEPLNQIGMWEESFKNNGDMYTPGSIIIPTNEKPDSLSEDTSHGTEGTPHKFDQEASTSRHPDKIQRRLAQNREAARKSRLRKKAYVQQLETSRLKLIHLEQELDRARQQGFYVGNGVDTNALSFSDNMSSGIVAFEMEYGHWVEEQNRQICELRTVLHGQVSDIELRSLVENAMKHYFQLFRMKSAAAKIDVFYVMSGMWKTSAERFFLWIGGFRPSELLKVLLPHFDPLTDQQLLDVCNLRQSCQQAEDALSQGMEKLQHTLAESVAAGKLGEGSYIPQMTCAMERLEALVSFVNQADHLRHETLQQMHRILTTRQAARGLLALGEYFQRLRALSSSWAARQREPT tga3_arath Transcription factor TGA3 TGA3 BZIP22 At1g22070 F2E2.14 bZIP transcription factor 22 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEMMSSSSSTTQVVSFRDMGMYEPFQQLSGWESPFKSDINNITSNQNNNQSSSTTLEVDARPEADDNNRVNYTSVYNNSLEAEPSSNNDQDEDRINDKMKRRLAQNREAARKSRLRKKAHVQQLEESRLKLSQLEQELVRARQQGLCVRNSSDTSYLGPAGNMNSGIAAFEMEYTHWLEEQNRRVSEIRTALQAHIGDIELKMLVDSCLNHYANLFRMKADAAKADVFFLMSGMWRTSTERFFQWIGGFRPSELLNVVMPYVEPLTDQQLLEVRNLQQSSQQAEEALSQGLDKLQQGLVESIAIQIKVVESVNHGAPMASAMENLQALESFVNQADHLRQQTLQQMSKILTTRQAARGLLALGEYFHRLRALSSLWAARPREHT tga2_arath Transcription factor TGA2 TGA2 BZIP20 HBP1B At5g06950 MOJ9.12 HBP-1b homolog bZIP transcription factor 20 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADTSPRTDVSTDDDTDHPDLGSEGALVNTAASDSSDRSKGKMDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFISGTGDQAHSTGGNGALAFDAEHSRWLEEKNKQMNELRSALNAHAGDSELRIIVDGVMAHYEELFRIKSNAAKNDVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLANQLEPMTERQLMGINNLQQTSQQAEDALSQGMESLQQSLADTLSSGTLGSSSSGNVASYMGQMAMAMGKLGTLEGFIRQADNLRLQTLQQMIRVLTTRQSARALLAIHDYFSRLRALSSLWLARPRE pr1-arath-dna-1 PR gene promoter dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress npr1-tga1-2 NPR1 interacts with truncated TGA1 758281 N/A 758284 unspecified role unspecified role bait bait N/A 758285 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 1 Table 1 The authors state that "the truncated forms of these six factors also exhibited differential interaction with NPR1, with the following order of apparent affinity: DTGA2 > DTGA3, DTGA5, DTGA6 > DTGA1 > DTGA4". However full length "TGAs differentially interact with NPR1, with the following order of apparent affinity: TGA3 > TGA2 > TGA5 > TGA6 > TGA1". npr1-tga5-3 NPR1 interacts with truncated TGA5 758281 N/A 758286 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 758284 unspecified role unspecified role bait bait physical association physical association false false false Figure 1 Table 1 The authors state that "the truncated forms of these six factors also exhibited differential interaction with NPR1, with the following order of apparent affinity: DTGA2 > DTGA3, DTGA5, DTGA6 > DTGA1 > DTGA4". However full length "TGAs differentially interact with NPR1, with the following order of apparent affinity: TGA3 > TGA2 > TGA5 > TGA6 > TGA1". npr1-tga6-3 NPR1 interacts with TGA6 758281 N/A 758284 unspecified role unspecified role bait bait N/A 758287 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 1 The authors state that "the truncated forms of these six factors also exhibited differential interaction with NPR1, with the following order of apparent affinity: DTGA2 > DTGA3, DTGA5, DTGA6 > DTGA1 > DTGA4". However full length "TGAs differentially interact with NPR1, with the following order of apparent affinity: TGA3 > TGA2 > TGA5 > TGA6 > TGA1". npr1-tga4-1 NPR1 interacts with TGA4 758281 N/A 758288 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 758284 unspecified role unspecified role bait bait physical association physical association false false false Table 1 The authors state that "the truncated forms of these six factors also exhibited differential interaction with NPR1, with the following order of apparent affinity: DTGA2 > DTGA3, DTGA5, DTGA6 > DTGA1 > DTGA4". However full length "TGAs differentially interact with NPR1, with the following order of apparent affinity: TGA3 > TGA2 > TGA5 > TGA6 > TGA1". The full length form of TGA4 did not interact with the bait protein. npr1-tga3-4 NPR1 interacts with TGA3 758281 N/A 758289 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 758284 unspecified role unspecified role bait bait P93002:p.Cys150Tyr mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false P93002:p.His300Tyr mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false P93002:p.His334Tyr mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false P93002:p.Pro342Ser mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 1 Table 2 The authors state "all four npr1 point mutations known to disrupt SA signaling in planta also prevent NPR1 from interacting with several TGA family members in yeast. Furthermore, since all four mutations are in the ankyrin repeat region, these results provide further evidence that this region is critical for binding the TGA factors". The authors state that "the truncated forms of these six factors also exhibited differential interaction with NPR1, with the following order of apparent affinity: DTGA2 > DTGA3, DTGA5, DTGA6 > DTGA1 > DTGA4". However full length "TGAs differentially interact with NPR1, with the following order of apparent affinity: TGA3 > TGA2 > TGA5 > TGA6 > TGA1". npr1-tga2-5 NPR1 interacts with TGA2 758281 N/A 758290 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 758284 unspecified role unspecified role bait bait P93002:p.Cys150Tyr mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false P93002:p.His300Tyr mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false P93002:p.His334Tyr mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false P93002:p.Pro342Ser mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 2 Table 1 The authors state "all four npr1 point mutations known to disrupt SA signaling in planta also prevent NPR1 from interacting with several TGA family members in yeast. Furthermore, since all four mutations are in the ankyrin repeat region, these results provide further evidence that this region is critical for binding the TGA factors". The authors state that "the truncated forms of these six factors also exhibited differential interaction with NPR1, with the following order of apparent affinity: DTGA2 > DTGA3, DTGA5, DTGA6 > DTGA1 > DTGA4". However full length "TGAs differentially interact with NPR1, with the following order of apparent affinity: TGA3 > TGA2 > TGA5 > TGA6 > TGA1". npr1-tga1-1 NPR1 interacts with truncated TGA1 758282 N/A 758284 unspecified role unspecified role bait bait N/A 758285 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false npr1-tga5-2 NPR1 interacts with truncated TGA5 758282 N/A 758284 unspecified role unspecified role bait bait N/A 758286 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false tga2-dna-2 TGA2 interacts with the PR1 gene promoter 758283 N/A 758290 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 758291 unspecified role unspecified role bait bait direct interaction direct interaction false false false Figure 6A The authors noted that "binding was specific. TGA2 and TG3 failed to bind a mutated form of this oligonucleotide (M-LS7) corresponding to the linker-scanning mutation that disrupted the TGACG element and eliminated SA and INA inducibility of a reporter gene". tga3-dna-3 TGA3 interacts with the PR1 gene promoter 758283 N/A 758289 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A-x 758291 unspecified role unspecified role bait bait direct interaction direct interaction false false false Figure 6B