IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ das-2000-1 The Agrobacterium T-DNA transport pore proteins VirB8, VirB9, and VirB10 interact with one another. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Das A., Xie YH. anath@biosci.cbs.umn.edu J. Bacteriol. (0021-9193) 2000 Only protein-protein interactions imex curation das-2000-2 The Agrobacterium T-DNA transport pore proteins VirB8, VirB9, and VirB10 interact with one another. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Das A., Xie YH. anath@biosci.cbs.umn.edu J. Bacteriol. (0021-9193) 2000 Only protein-protein interactions imex curation virb7_agrfc Outer membrane lipoprotein virB7 virB7 AGR_pTi_10.1 Atu6173 protein protein agrt5 Agrobacterium tumefaciens (strain C58 / ATCC 33970) Agrobacterium tumefaciens (strain C58) MKYCLLCLALALGGCQTNDKLASCKGPIFPLNVGRWQPTPSDLQLSNVGGRHEGV virb9_agrfc Protein virB9 virB9 AGR_pTi_12 Atu6175 protein protein agrt5 Agrobacterium tumefaciens (strain C58 / ATCC 33970) Agrobacterium tumefaciens (strain C58) MTKKAFLTLACLLFAAIGARAEDTPTAGRLDPRMRYLAYNPDQVVRLSTAVGATLVVTFGANETVTAVAVSNSKDLAALPRGNYLFFKASKVLPPQPVVVLTASDAGMRRYVFSISSKTLPHLDKEQADLYYSVQFAYPADDAAARQKAAQEKAVADRIRAEAQYQQRAEGLLEQPATTVGAEDKNWHYVAQGDRSLLPLEVFDDGFTTVFHFPGNVRIPSIYTINPDGKEAVANYSVKGSYVEISSVSRGWRLRDGHTVLCIWNTAYDPVGRRPETGTVRPDVKRVLKEVRG virb8_agrfc Protein virB8 virB8 AGR_pTi_11 Atu6174 protein protein agrt5 Agrobacterium tumefaciens (strain C58 / ATCC 33970) Agrobacterium tumefaciens (strain C58) MKGSEYALLVARETLAEHYKEVEAFQTARAKSARRLSKVIAAVATIAVLGNVAQAFTIATMVPLIRLVPVYLWIRPDGTVDSEVSVSRLPATQEEAVVNASLWEYVRLRESYDADTAQYAYDLVSNFSAPMVRQNYQQFFNYPNPTSPQVILGKHGRLEVEHIASNDVTPGVQQIRYKRTLIVDGKMPMASTWTATVRYEKVTSLPGRLRLTNPGGLVVTSYQTSEDTVSNAGHSEP virba_agrfc Protein virB10 virB10 AGR_pTi_13 Atu6176 protein protein agrt5 Agrobacterium tumefaciens (strain C58 / ATCC 33970) Agrobacterium tumefaciens (strain C58) MNDDNQQSAHDVDASGSLVSDTHHRRLSGAQKLIVGGVVLALSLSLIWLGGREKKENGDAPPSTMIATNTKPFHPAPIDVTLDPPAAQEAVQPTAPPPARSEPERHEPRPEETPIFAYTSGDQGTSKRVQQGETDRRREGNGEDSPLPKVEVSAENDLSIRMKPTELQPTRATLLPHPDFMVTEGTIIPCILQTAIDTSLAGYVKCVLPWDVRGTTNNVVLLDRGTTVVGEIQRGLQQGDARVFVLWDRAETPDHAMISLASPSADELGRSGLPGTVDNHFWQRFSGAMLLSVVQGAFQAASTYAGSSGGGTSFNSVQNNGEQTADTALKATINIPPTLKKNQGDTVSIFVARDLDFSGIYQLRMAGRAARGRDRRP virb7-virb9 770577 n/a 770579 unspecified role unspecified role bait bait n/a 770580 unspecified role unspecified role prey prey physical association physical association false false false 1 virb7-virb7 770577 n/a 770579 unspecified role unspecified role bait bait n/a 770579 unspecified role unspecified role prey prey physical association physical association false false false 1 weak interaction observed virb8-virb9 770577 n/a 770581 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P17798:p.Ser87Leu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false n/a 770580 unspecified role unspecified role prey prey physical association physical association false false false 1, 3A virb8-virb10 770577 n/a 770582 unspecified role unspecified role prey prey n/a 770581 unspecified role unspecified role bait bait P17798:p.Ser87Leu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1, 4 virb10-virb10 770577 n/a 770582 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 770582 unspecified role unspecified role prey prey physical association physical association false false false 1, 3D virb9-virb9 770577 n/a 770580 unspecified role unspecified role prey prey n/a 770580 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1, 3B virb9-virb10 770577 n/a 770582 unspecified role unspecified role prey prey n/a 770580 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1, 3C virb8-virb8 770577 n/a 770581 unspecified role unspecified role prey prey n/a 770581 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P17798:p.Ser87Leu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1, 4, 3B virb9-virb8 770577 n/a 770581 unspecified role unspecified role prey prey n/a 770580 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 3B virb10-virb8 770577 n/a 770582 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 770581 unspecified role unspecified role prey prey physical association physical association false false false 3D virb10-virb9 770577 n/a 770580 unspecified role unspecified role prey prey n/a 770582 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 3D virb9-virb10-1 770578 n/a 770580 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 770582 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 2 Only the periplasmic region was fused to the GST baits. virb8-virb10-1 770578 n/a 770581 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false periplasmic region sufficient to bind sufficient binding region sufficient to bind range range range range false ecoli Escherichia coli (strain K12) n/a 770582 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 2 very weak interaction observed Periplasmic region derived from UniprotKB annotations. virb10-virb10-1 770578 n/a 770582 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 770582 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 2 Only the periplasmic region was fused to GST bait.