IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ karniol-1999-1 Arabidopsis FUSCA5 encodes a novel phosphoprotein that is a component of the COP9 complex. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Karniol B., Malec P., Chamovitz DA. chamd@post.tau.ac.il Plant Cell (1040-4651) 1999 Only protein-protein interactions imex curation csn8_arath COP9 signalosome complex subunit 8 Constitutive photomorphogenesis protein 9 Protein FUSCA 7 CSN8 COP9 FUS7 At4g14110 dl3095c protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDLSPVKEALAAKSFDKIADICDTLMLQVASEGIEYHDDWPYAIHLLGYFYVDDCDSARFLWKRIPTAIKERKPEVVAAWGIGQKLWTHDYAGVYEAIRGYDWSQEAKDMVAAFSDLYTKRMFQLLLSAYSTITIHDLALFLGMTEDDATTYVVENGWTVDAASQMASVKKQAVKREQKVDSSKLQRLTEYVFHLEH csn7_arath COP9 signalosome complex subunit 7 Protein FUSCA 5 FUS5 At1g02090 T7I23.24 T7I23.25 CSN7 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDIEQKQAEIIDQLVKRASTCKSEALGPLIIEATSHPSLFAFSEILALPNVAQLEGTTDSVYLDLLRLFAHGTWGDYKCNATRLPHLSPDQILKLKQLTVLTLAESNKVLPYDTLMVELDVSNVRELEDFLINECMYAGIVRGKLDQLKRCFEVPFAAGRDLRPGQLGNMLHTLSNWLNTSENLLISIQDKIKWADNMSEMDKKHRKEAEEGVEEVKKSLSMKGDVDIRGNKEMFGEPSGVMDYEEDGIRPKRRRHPVTR csn1_arath COP9 signalosome complex subunit 1 Constitutive photomorphogenesis protein 11 Protein FUSCA 6 CSN1 COP11 FUS6 At3g61140 T20K12.40 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MERDEEASGPMMEMCTNGGEETSNRRPIISGEPLDIEAYAALYKGRTKIMRLLFIANHCGGNHALQFDALRMAYDEIKKGENTQLFREVVNKIGNRLGEKYGMDLAWCEAVDRRAEQKKVKLENELSSYRTNLIKESIRMGYNDFGDFYYACGMLGDAFKNYIRTRDYCTTTKHIIHMCMNAILVSIEMGQFTHVTSYVNKAEQNPETLEPMVNAKLRCASGLAHLELKKYKLAARKFLDVNPELGNSYNEVIAPQDIATYGGLCALASFDRSELKQKVIDNINFRNFLELVPDVRELINDFYSSRYASCLEYLASLKSNLLLDIHLHDHVDTLYDQIRKKALIQYTLPFVSVDLSRMADAFKTSVSGLEKELEALITDNQIQARIDSHNKILYARHADQRNATFQKVLQMGNEFDRDVRAMLLRANLLKHEYHARSARKL csn7-csn8 FUS5 (CSN7) protein interacts with COP9 (CSN8) protein 723806 N/A 723807 unspecified role unspecified role prey prey N/A 723808 unspecified role unspecified role bait bait c-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 5 csn7-csn1 FUS5 (CSN7) protein interacts with FUS6 (CSN1) protein 723806 N/A 723808 unspecified role unspecified role bait bait c-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 723809 unspecified role unspecified role prey prey physical association physical association false false false Figure 5