UniProt UniProt http://www.uniprot.org purdue-1998-2 Pex18p and Pex21p, a novel pair of related peroxins essential for peroxisomal targeting by the PTS2 pathway. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Purdue PE., Yang X., Lazarow PB. epurdue@smtplink.mssm.edu USA.epurdue@smtplink.mssm.edu J. Cell Biol. (0021-9525) 1998 Only protein-protein interactions imex curation purdue-1998-1 Pex18p and Pex21p, a novel pair of related peroxins essential for peroxisomal targeting by the PTS2 pathway. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Purdue PE., Yang X., Lazarow PB. epurdue@smtplink.mssm.edu USA.epurdue@smtplink.mssm.edu J. Cell Biol. (0021-9525) 1998 Only protein-protein interactions imex curation purdue-1998-3 Pex18p and Pex21p, a novel pair of related peroxins essential for peroxisomal targeting by the PTS2 pathway. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Purdue PE., Yang X., Lazarow PB. epurdue@smtplink.mssm.edu USA.epurdue@smtplink.mssm.edu J. Cell Biol. (0021-9525) 1998 Only protein-protein interactions imex curation thik_yeast 3-ketoacyl-CoA thiolase, peroxisomal POT1 FOX3 POX3 YIL160C Beta-ketothiolase Acetyl-CoA acyltransferase Peroxisomal 3-oxoacyl-CoA thiolase protein protein yeast Saccharomyces cerevisiae Baker's yeast MSQRLQSIKDHLVESAMGKGESKRKNSLLEKRPEDVVIVAANRSAIGKGFKGAFKDVNTDYLLYNFLNEFIGRFPEPLRADLNLIEEVACGNVLNVGAGATEHRAACLASGIPYSTPFVALNRQCSSGLTAVNDIANKIKVGQIDIGLALGVESMTNNYKNVNPLGMISSEELQKNREAKKCLIPMGITNENVAANFKISRKDQDEFAANSYQKAYKAKNEGLFEDEILPIKLPDGSICQSDEGPRPNVTAESLSSIRPAFIKDRGTTTAGNASQVSDGVAGVLLARRSVANQLNLPVLGRYIDFQTVGVPPEIMGVGPAYAIPKVLEATGLQVQDIDIFEINEAFAAQALYCIHKLGIDLNKVNPRGGAIALGHPLGCTGARQVATILRELKKDQIGVVSMCIGTGMGAAAIFIKE B22AA06130829DE5 pex7_yeast Peroxisomal targeting signal 2 receptor PEX7 PAS7 PEB1 YDR142C YD2943.01C YD9302.18C Peroxin-7 Peroxisome import protein PAS7 protein protein yeast Saccharomyces cerevisiae Baker's yeast MLRYHMQGFSGYGVQYSPFFDNRLAVAAGSNFGLVGNGKLFILEIDRSGRIVEVNSFLTQDCLFDLAWNESHENQVLVAQGDGTLRLFDTTFKEFPIAIFKEHEREVFSCNWNLVNRQNFLSSSWDGSIKIWSPLRKQSLMTLTPRPLEITKMVDPLNAIILKKKSFTGISKNRNCVYQAQFSPHDQNLVLSCSGNSYASLFDIRLPSGKNQNNFLVHSGLEALTCDFNKYRPYVVATGGVDNAIRIWDIRMLNKNESATIKRTVPGQLHNSSCINEIPNAHGLAIRKVTWSPHHSNILMSASYDMTCRIWRDLSNDGAKETYKTNSTDATKGSIFNFTQHSEFVFGADWSLWGKPGYVASTAWDGNLFVWNGLG 7D53A42A8ACF23F9 pex18_yeast Peroxisomal membrane protein PEX18 YHR160C Peroxin-18 PEX18 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNSNRCQTNEVNKFISSTEKGPFTGRDNTLSFNKIGSRLNSPPILKDKIELKFLQHSEDLNQSRSYVNIRPRTLEDQSYKFEAPNLNDNETSWAKDFRYNFPKNVEPPIENQIANLNINNGLRTSQTDFPLGFYSQKNFNIASFPVVDHQIFKTTGLEHPINSHIDSLINAEFSELEASSLEEDVHTEEENSGTSLEDEETAMKGLASDIIEFCDNNSANKDVKERLNSSKFMGLMGSISDGSIVLKKDNGTERNLQKHVGFCFQNSGNWAGLEFHDVEDRIA 574C644FD7ED7A71 pex21_yeast Peroxisomal membrane protein PEX21 YGR239C G8593 Peroxin-21 PEX21 protein protein yeast Saccharomyces cerevisiae Baker's yeast MPSVCHTSPIEKIIQQGHRIQNDSLIPSKRTKLAHTELTAHYATEDSHVEKHFLHNGSNFDGIDNVRYQNQPSPLTFITPNNTVDSSDWVPQFSSMKIDDSLEFSSEYKRLYSNYESQQRLNSSRQHLPFKNCMIRKTSCTYPPQKTLRQQRQGNRDNPTDAFQFDAEFQVLEREIQKERYEPITRRDEKWFDQDQSELQRIATDIVKCCTPPPSSASSSSTLSSSVESKLSESKFIQLMRNISSGDVTLKKNADGNSASELFSSNNGELVGNRHIFVKDEIHKDILD 0197257317ADE4FF pex7-fox3-1 664682 N/A 664685 unspecified role unspecified role prey prey N/A 664686 unspecified role unspecified role bait bait physical association physical association false false false 1 Deletions of Pex18 and Pex21 do not change the interaction. fox3-pex18-1 664682 N/A 664687 unspecified role unspecified role prey prey N/A 664685 unspecified role unspecified role bait bait n-terminus sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1 No interaction was seen if PEX7 was deleted. fox3-pex21-1 664682 N/A 664688 unspecified role unspecified role prey prey N/A 664685 unspecified role unspecified role bait bait physical association physical association false false false 1 Deletion of Met-1 to Ala-16 increases the interaction pex7-pex18-2 664682 N/A 664686 unspecified role unspecified role bait bait N/A 664687 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1 pex7-pex21-2 664682 N/A 664688 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 664686 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false 1 pex7-pex18-1 664683 N/A 664686 unspecified role unspecified role bait bait N/A 664687 unspecified role unspecified role prey prey physical association physical association false false false 1 Deletions of PEX13 and PEX14 do not change the interaction. pex7-pex21-1 664683 N/A 664688 unspecified role unspecified role prey prey N/A 664686 unspecified role unspecified role bait bait physical association physical association false false false 1 Deletions of PEX13 and PEX14 do not change the interaction. pex18-pex7-1 664684 N/A 664687 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 664686 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 2 pex21-pex7-1 664684 N/A 664686 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 664688 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false 2