IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ brown-1994-1 Subunits of the Saccharomyces cerevisiae signal recognition particle required for its functional expression. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Brown JD., Hann BC., Medzihradszky KF., Niwa M., Burlingame AL., Walter P. Immunoaffinity chromatography with anti-Sec65p antibodies was carried out on yeast post-ribosomal supernatant fractionated by DEAE-Sepaharose chromatography. Matter eluted from the column was precipitated in TCA and subjected to SDS-PAGE. Bands were excised from gels and proteins digested in situ with trypsin and their mass determined by electrospray mass spectrometry. Peptides were then sequenced by either Edman degradation or tandem mass spectrometry. EMBO J. (0261-4189) 1994 Only protein-protein interactions imex curation brown-1994-2 Subunits of the Saccharomyces cerevisiae signal recognition particle required for its functional expression. in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom weight by comassie molecular weight estimation by coomasie staining weight by comassie Brown JD., Hann BC., Medzihradszky KF., Niwa M., Burlingame AL., Walter P. Immunoaffinity chromatography with anti-Sec65p antibodies was carried out on yeast post-ribosomal supernatant fractionated by DEAE-Sepaharose chromatography. Matter eluted from the column was precipitated in TCA and subjected to SDS-PAGE. Bands were excised from gels and proteins digested in situ with trypsin and their mass determined by electrospray mass spectrometry. Peptides were then sequenced by either Edman degradation or tandem mass spectrometry. EMBO J. (0261-4189) 1994 Only protein-protein interactions imex curation brown-1994-3 Subunits of the Saccharomyces cerevisiae signal recognition particle required for its functional expression. in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom ms participant Identification by mass spectrometry ms participant Brown JD., Hann BC., Medzihradszky KF., Niwa M., Burlingame AL., Walter P. Immunoaffinity chromatography with anti-Sec65p antibodies was carried out on yeast post-ribosomal supernatant fractionated by DEAE-Sepaharose chromatography. Matter eluted from the column was precipitated in TCA and subjected to SDS-PAGE. Bands were excised from gels and proteins digested in situ with trypsin and their mass determined by electrospray mass spectrometry. Peptides were then sequenced by either Edman degradation or tandem mass spectrometry. EMBO J. (0261-4189) 1994 Only protein-protein interactions imex curation sec65_yeast Signal recognition particle subunit SEC65 YM8339.14C YML105C SEC65 protein protein yeast Saccharomyces cerevisiae Baker's yeast MPRLEEIDDFNDIDDLDMELAELDPSLRTPIAPKITPKVVRSQDQENPAFLPGTNNNSNSNNNSSNEKEQLSFINPKTGKVERSEAISKKDLEEVKRFQVLYPCYFDINRSHKEGRRVPKELAVENPLAKTMADAVRELGILCIFEGEKCHPQDFGNPGRIRVLFKENGQLIGAATKFKGGKRQLMKAVGEYMKRHPTTIESLREIPYGPDFDNIEFKKIPRVKGFKMNEIVPLHSPFLMGHPMTKSVYETPKITAAEKSFKPPKNKYKVVRR srp14_yeast Signal recognition particle subunit SRP14 SRP14 YDL092W D2404 Signal recognition particle 14 kDa protein homolog protein protein yeast Saccharomyces cerevisiae Baker's yeast MANTGCLSPGAFLSKVPEFFQTANEKHITVRLTAKRLIEHDPVEGNLEFDSTNHPDYDVSKKASEISVSSRSDREYPLLIRMSYGSHDKKTKCSTVVKASELDQFWQEYSSVFKGGMQNLIKKKKKKSKNGTISKTGKKNKVAKKN srp54_yeast Signal recognition particle subunit SRP54 SRH1 P9513.14 YPR088C SRP54 Signal recognition particle 54 kDa protein homolog protein protein yeast Saccharomyces cerevisiae Baker's yeast MVLADLGKRINSAVNNAISNTQDDFTTSVDVMLKGIVTALLESDVNIALVSKLRNNIRSQLLSENRSEKSTTNAQTKKLIQKTVFDELCKLVTCEGSEEKAFVPKKRKTNIIMFVGLQGSGKTTSCTKLAVYYSKRGFKVGLVCADTFRAGAFDQLKQNAIRARIPFYGSYTETDPAKVAEEGINKFKKEKFDIIIVDTSGRHHQEEELFQEMIEISNVIKPNQTIMVLDASIGQAAEQQSKAFKESSDFGAIILTKMDGHARGGGAISAVAATNTPIIFIGTGEHIHDLEKFSPKSFISKLLGIGDIESLFEQLQTVSNKEDAKATMENIQKGKFTLLDFKKQMQTIMKMGPLSNIAQMIPGMSNMMNQVGEEETSQKMKKMVYVLDSMTKEELESDGRMFIEEPTRMVRVAKGSGTSVFEVEMILMQQQMMARMAQTATQQQPGAPGANARMPGMPNMPGMPNMPGMPNMPGMPKVTPQMMQQAQQKLKQNPGLMQNMMNMFGGGMGGGMGGGMPDMNEMMKMMQDPQMQQMAKQFGMG 05B1B2C262932F17 srp21_yeast Signal recognition particle subunit SRP21 SRP21 YKL122C YKL527 Signal recognition particle 21 kDa protein protein protein yeast Saccharomyces cerevisiae Baker's yeast MSVKPIDNYITNSVRLFEVNPSQTLFSISYKPPTQKTDTKVSFRTHNSHLSLNYKFTTNKSKDVSRLLSALGPRGVSITPGKIEKIAQSKKKNNKIKESSKKIKGKSIQDIVGLATLIVNTDVEKSDPAAKKTATEPKQKANAVQNNNGNSAASKKKKNKNKGKKKR srp68_yeast Signal recognition particle subunit SRP68 YPL243W SRP68 Signal recognition particle 68 kDa protein homolog protein protein yeast Saccharomyces cerevisiae Baker's yeast MVAYSPIIATYGNRAEQFLETDSDFAKYHAKLNKKLQHLRSRCHLVTKDTKKYSSKNKYGEINSEDYDNKTKLIGVLILLHAERDLALAETLKLRARQRGKLKKSEEKVLSTRLKKACKTADKLVNVTQNEQQWITRAQYLAFAKLVHSEYLINGKRFKRKDNAKISNNLALVFAALEHLKNLSLLAEEVVDNIVNKYQYSLKQYAGNLITTPEINNFIVERVQSDENKDDELVKLLLDNGFNMKKITTSTEDQKVTTNINWRSFNAKIIDAEVAQFLEQGLSIHPTQITQYTQRLSKLEKALDRHEFFIANHDDQDDIDEMVENSSENNQIILAYIKYNILLTSISRERDLFTHLWNQWLKLNTSLPSKLTKYKEMERIVKNLTKYLSDIMELPGVYSDDELLSQLDLCKLYFQLFLNTGCLSVLYQSKGRYMEALALYVDAYRRLENKLSEIESLDEILLPANLLSLNSVRSLQKRIENGGNSVITLAEYEKRNHGGSLGKYDLTVIEKLDSKKILPTDIQLKNLFPLKPKMLPIPSKPTLFDLAFNYITYDKQEPSASQVKDSVTETESISQTPISNEQTEGEPKKKRGFLGLFGR srp72_yeast Signal recognition particle subunit SRP72 YPL210C SRP72 Signal recognition particle 72 kDa protein homolog protein protein yeast Saccharomyces cerevisiae Baker's yeast MAKDNLTNLLSQLNIQLSQDEHSQVEQTCVKLLDSGCENPADVFRRCLVAVIQQDKYQKALHYLKKFKHIDDKYGRKFALEKLYIFYKLNMPDEFNTLYTAIITDDLDTVLKKDIESLRGILHVRAQYCYKNGLYQEAFKIYQHLASHNEKDQDSQIELSCNERVPLSVATELMNRSPLVTPMDESSYDLLFNESFIMASVGKYDKAIELLEKALQGATNEGYQNDINTIKLQLSFVLQMVGKTAQSKEILKGLLQELKADSPFSLICQNNLNAFVDFSKYNTNFNLLLRELNVEKLNTFNLQTFTHEQWSNIQRNVLFLRLFNNVKIHSQESLLSRTFDKYSKLVDNVTLESYKTQAKKLYHHTTKTILSGTDGSTIGILLLTIQLLIIEKEWENAIRIGELFLNESWKSSFEKFNDSQAIVCYILFELYKIKGRNNSKSVLLKKLGSVRVQLSGKIQENIPFWKHVGFELLSMGNAKESKALLREISNFSKGDADVLVDRVVSSDSLDIAQGIDLVRDIDIDKLIQLGVKPLESSAKRSKNTAVSKVQKRKVLELKKKRKIKRLEKFLQGRDTSKLPDPERWLPLRDRSTYRPKKKQQGAKQTQGGAMNKKSEQALDISKKGKPTVNKKPKNKKKGRK sec65-srp14-1 Sec65p coimmunoprecipitates the Srp14p and Srp54p subunits of the SRP from yeast extracts 607354 N/A 607357 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 607358 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 607359 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 1 B The doublet of bands migrating at 66 kDA consists of Srp68p and Srp72p. These two proteins were not resolved in the gel and thus have not been added to this interaction. sec65-srp14-2 Srp21p, Srp54p and Srp14p copurify with Sec65p 607355 N/A 607360 unspecified role unspecified role prey prey N/A 607359 unspecified role unspecified role prey prey N/A 607357 unspecified role unspecified role bait bait N/A 607358 unspecified role unspecified role prey prey association association false false false The doublet of bands migrating at 66 kDA consists of Srp68p and Srp72p. These two proteins were not resolved in the gel and thus have not been added to this interaction. 2 A sec65-srp14-3 Srp14p, Srp21p, Srp54p, Srp68p and Srp72p copurify with Sec65p 607356 N/A 607358 unspecified role unspecified role prey prey N/A 607361 unspecified role unspecified role prey prey N/A 607357 unspecified role unspecified role bait bait N/A 607359 unspecified role unspecified role prey prey N/A 607360 unspecified role unspecified role prey prey N/A 607362 unspecified role unspecified role prey prey association association false false false Table 1