IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ yang-2007b-2 p31(comet) Blocks Mad2 Activation through Structural Mimicry. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Yang M., Li B., Tomchick DR., Machius M., Rizo J., Yu H., Luo X. Sequence of MBP1 peptide taken from PMID:11804586 xuelian.luo@utsouthwestern.edu Cell (0092-8674) 2007 Only protein-protein interactions 5 imex curation yang-2007b-1 p31(comet) Blocks Mad2 Activation through Structural Mimicry. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Yang M., Li B., Tomchick DR., Machius M., Rizo J., Yu H., Luo X. Sequence of MBP1 peptide taken from PMID:11804586 xuelian.luo@utsouthwestern.edu Cell (0092-8674) 2007 Only protein-protein interactions 5 imex curation yang-2007b-3 p31(comet) Blocks Mad2 Activation through Structural Mimicry. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Yang M., Li B., Tomchick DR., Machius M., Rizo J., Yu H., Luo X. Sequence of MBP1 peptide taken from PMID:11804586 xuelian.luo@utsouthwestern.edu Cell (0092-8674) 2007 Only protein-protein interactions 5 imex curation yang-2007b-4 p31(comet) Blocks Mad2 Activation through Structural Mimicry. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Yang M., Li B., Tomchick DR., Machius M., Rizo J., Yu H., Luo X. Constructs used in this experiment assumed to be the same as those used for crystallisation as this is not clear in the paper. Sequence of MBP1 peptide taken from PMID:11804586 xuelian.luo@utsouthwestern.edu Cell (0092-8674) 2007 Only protein-protein interactions 5 imex curation md2l1_human Mitotic spindle assembly checkpoint protein MAD2A MAD2L1 MAD2 Mitotic arrest deficient 2-like protein 1 protein protein human Homo sapiens Human MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND md2bp_human MAD2L1-binding protein Caught by MAD2 protein MAD2L1BP CMT2 KIAA0110 p31(comet) protein protein human Homo sapiens Human MAAPEAEVLSSAAVPDLEWYEKSEETHASQIELLETSSTQEPLNASEAFCPRDCMVPVVFPGPVSQEGCCQFTCELLKHIMYQRQQLPLPYEQLKHFYRKPSPQAEEMLKKKPRATTEVSSRKCQQALAELESVLSHLEDFFARTLVPRVLILLGGNALSPKEFYELDLSLLAPYSVDQSLSTAACLRRLFRAIFMADAFSELQAPPLMGTVVMAQGHRNCGEDWFRPKLNYRVPSRGHKLTVTLSCGRPSIRTTAWEDYIWFQAPVTFKGFRE mad2 peptide MAD2 binding peptide 1 peptide peptide polypeptide oligopeptide oligopeptide polypeptide in vitro In vitro SWYSYPPPQRAV An amino acid sequence which is not represented in UniProt mad2l1bp-mad2l1-2 Interaction between MAD2L1BP and MAD2L1 demonstrated by pull down 682506 N/A 682510 unspecified role unspecified role bait bait Q13257:p.Leu13Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 682511 unspecified role unspecified role prey prey Q15013:p.[Gln83Ala;Phe191Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q15013:p.Gln83Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q15013:p.Phe191Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false Fig. 5A, Supp. Fig. 5 mad2l1bp-mad2l1-4 Interaction between MAD2L1BP and MAD2L1 demonstrated by pull down 682506 N/A 682510 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q13257:p.Arg133Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q13257:p.Phe141Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q13257:p.Arg184Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) N/A 682511 unspecified role unspecified role prey prey ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false Supp. Fig. 4 mad2l1bp-mad2l1-1 MAD2L1BP-MAD2L1 crystallized with a stabilizing peptide 682507 N/A 682512 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) Stoichiometry: 1.0 N/A 682510 unspecified role unspecified role neutral component neutral component Q13257:p.Leu13Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) Stoichiometry: 1.0 N/A 682511 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) Stoichiometry: 1.0 direct interaction direct interaction false false false 2.3 A Figs. 1B and 4, Table 1 R working 18.9%, R free 25.8% mad2l1bp-mad2l1-3 Interaction between MAD2L1BP and MAD2L1 demonstrated by coimmunoprecipitation 682508 N/A 682510 unspecified role unspecified role prey prey ecobb Escherichia coli (strain B / BL21) N/A 682511 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q15013:p.[Gln83Ala;Phe191Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false Fig. 5B mad2l1bp-mad2l1-41 MAD2L1BP-MAD2L1 identified by gel filtration 682509 N/A 682510 unspecified role unspecified role neutral component neutral component Q13257:p.Leu13Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) Stoichiometry: 1.0 N/A 682511 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) Stoichiometry: 1.0 direct interaction direct interaction false false false Supp Fig 2C calculated molecular mass = 51 kD.