IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ hayashi-2007-5 Sigma-1 Receptor Chaperones at the ER- Mitochondrion Interface Regulate Ca(2+) Signaling and Cell Survival. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Hayashi T., Su TP. Interaction demonstrated in purified mitochondria-associated ER membranes thayashi@intra.nida.nih.gov Cell (0092-8674) 2007 Only protein-protein interactions 13 imex curation hayashi-2007-2 Sigma-1 Receptor Chaperones at the ER- Mitochondrion Interface Regulate Ca(2+) Signaling and Cell Survival. crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hayashi T., Su TP. Interaction demonstrated in purified mitochondria-associated ER membranes thayashi@intra.nida.nih.gov Cell (0092-8674) 2007 Only protein-protein interactions 13 imex curation hayashi-2007-3 Sigma-1 Receptor Chaperones at the ER- Mitochondrion Interface Regulate Ca(2+) Signaling and Cell Survival. crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Hayashi T., Su TP. Interaction demonstrated in purified mitochondria-associated ER membranes thayashi@intra.nida.nih.gov Cell (0092-8674) 2007 Only protein-protein interactions 13 imex curation hayashi-2007-1 Sigma-1 Receptor Chaperones at the ER- Mitochondrion Interface Regulate Ca(2+) Signaling and Cell Survival. crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. immunodepletion immunodepleted coimmunoprecipitation immunodepleted coip immunodepletion weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Hayashi T., Su TP. Interaction demonstrated in purified mitochondria-associated ER membranes thayashi@intra.nida.nih.gov Cell (0092-8674) 2007 Only protein-protein interactions 13 imex curation hayashi-2007-4 Sigma-1 Receptor Chaperones at the ER- Mitochondrion Interface Regulate Ca(2+) Signaling and Cell Survival. crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. anti bait coip anti bait coimmunoprecipitation anti bait coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Hayashi T., Su TP. Interaction demonstrated in purified mitochondria-associated ER membranes thayashi@intra.nida.nih.gov Cell (0092-8674) 2007 Only protein-protein interactions 13 imex curation hayashi-2007-6 Sigma-1 Receptor Chaperones at the ER- Mitochondrion Interface Regulate Ca(2+) Signaling and Cell Survival. crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. fluorescence imaging fluorescence microscopy fluorescence imaging antibody detection identification by antibody antibody detection Hayashi T., Su TP. Interaction demonstrated in purified mitochondria-associated ER membranes thayashi@intra.nida.nih.gov Cell (0092-8674) 2007 Only protein-protein interactions 13 imex curation bip_rat Endoplasmic reticulum chaperone BiP Hspa5 Grp78 Immunoglobulin heavy chain-binding protein Steroidogenesis-activator polypeptide 78 kDa glucose-regulated protein Binding-immunoglobulin protein Heat shock protein 70 family protein 5 Heat shock protein family A member 5 protein protein rat Rattus norvegicus (Rat) Rat MKFTVVAAALLLLCAVRAEEEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVNDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSPEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPIISKLYGSGGPPPTGEEDTSEKDEL sgmr1_rat Sigma non-opioid intracellular receptor 1 Sigma 1-type opioid receptor Sigmar1 Oprs1 protein protein rat Rattus norvegicus (Rat) Rat MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRYWAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP bip_crigr Endoplasmic reticulum chaperone BiP HSPA5 78 kDa glucose-regulated protein Binding-immunoglobulin protein GRP78 Heat shock protein 70 family protein 5 Heat shock protein family A member 5 Immunoglobulin heavy chain-binding protein I79_019946 protein protein crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster MKFPMVAAALLLLCAVRAEEEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVNDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPIISKLYGSAGPPPTGEEDTSEKDEL a0a3l7i3a5_crigr Sigma 1-type opioid receptor Sigma non-opioid intracellular receptor 1 CgPICR_003176 protein protein crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster MQWSLGRRWAWIALFLAVAAVLTQAVWLWLGTQNFVFQQEEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP a0a3l7ikr8_crigr Inositol 1,4,5-trisphosphate receptor CgPICR_020497 protein protein crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster MNEMSSFLHIGDIVSLYAEGSVNGFISTLGLVDDRCVVEPAAGDLDNPPKKFRDCLFKVCPMNRYSAQKQYWKAKQTKQDKEKIADVVLLQKLQGLVSASLRAWPPRPSGLTPALPMPQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDATGNEGSWLFIQPFWKLRSNGDNVVVGDKVILNPVNAGQPLHASNYELSDNAGCKEVNSVNCNTSWKITLFMQFRDHLEDVLKGGDVVRLFHAEQEKFLTCDEYRGKLQVFLRTTLRQSATSATSSNALWEVEVVHHDPCRGGAGHWNGLYRFKHLATGNYLAAEGAQGRTGRRNAGEKIKYRLVAVPHGNDIASLFELDPTTLQKTDSFVPRNSYVRLRHLCTNTWIQSTNVPIDVEEERPIRLMVWALVHGLGPAGACPWPPADPCPSLQLGTCPTKEDKEAFAIVSVPVSEIRDLDFANDASSMLASAVEKLNDGFISQNDRRQDGRVPLTLYTPQIFGILKAPFRDKGGEGPLVRLEELSDQKNAPYQYMFRLCYRVLRHSQEDYRKNQEHIAKQFGMMQSQIGYDILAEDTITALLHNNRKLLEKHITKTEVETFLERRALGFPSRGQLLSLLLALLTPPRFLDYLSDLCVSNHIAIPVTQELICKCVLDPKNSDILIQTELRPVKEMAQSHEYLSIEYSEEEVWLTWTDRNNEHHEKSVRQLAQEARAGNAHDENVLSYYRYQLKLFARMCLDRQYLAIHEISKQLGVDLLFLCMADEMLPFDLRASFCHLMLHVHVDRDPQELVTPVKFARLWTEIPTAITIKDYDSNLNATRDDKKNKFASTMEFVEDYLNNVVSEAVPFANEEKNKLTFEVVSLAHNLIYFGFYSFSELLRLTRTLLGIIDCVQAPPAMMQAYEEPGGKNVRRSIQGVGHMVSTMVLSRKQSVFGTSGLPAGAGVPEPLDRSKFEDNEDIVVMETKLKILEILQFILNVRLDYRISYLLSVFKKEFVEVFPMQDSGADGTAPAFDSTTANMNLDRIGEQAEAMFGVGKTSSMLEVDDEGGRMFLRVLLHLTMHDYAPLVSGALQLLFKHFSQRQEAMHTFKQVQLLISAQDVENYKVIKSELDRLRTMVEKSELWVDKKGSVKGEEGEAGATKDKKEQPTDEEGFLQPHGEKSSENYQIVKGILERLNKMCGVGEQMRKKQQRLLKNMDAHKVMLDLLQIPYDKGDSKMLEILRYTHQFLQKFCAGNPGNQALLHKHLQLFLTPGLLEAETMQHIFLNNYQLCSEISEPVLQHCVHLLATHGRHVQYLDFLHTVIKAEGKYVKKCQDMIMTELTNAGDDVVVFYNDKASLAHLLDMMKAARDGVEDHSPLMYHISLVDLLAACAEGKNVYTEIKCTSLLPLEDVVTVVTHEDCITEVKMAYVNFVNHCYVDTEVEMKEIYTSNHIWTGEYPHWTFPGVPCWGHQPHSDHLIPGHECHPGWLPPARVCNKREKRLADPTLEKYVLTVVLDTINAFFSSPFSENSTSLQTHQTIVVQLLQSTTRLLECPWLQQQHKGSVEACVRTLAMVAKSRAILLPMDLDAHMSALLSSGGSCAAAAQRSAANYKTATRTFPRVIPTANQWDYKNIIEKLQDIITALEERLKPLVQAELSVLVDVLHWPELLFLEGSEAYQRCESGGFLSKLIRHTKGLMESEEKLCVKVLRTLQQMLLKKNKYGDRGNQLRKMLLQNYLQNRKSSSRGELPDPSGSGLDQDWSAIAATQCRLDKEGATKLVCDLITSTKNEKIFQESIGLAIRLLDGGNTEIQKSFYNLMTGDKKSERFFRVLHDRMKRAQQETKSTVAVNMSDLGSQPREDREPVDPTTKGRVASFSMPSSSRYSLGPSLHRGREASDRVQSSEMGASVLVMRPILRFLQLLCENHNRDLQNFLRCQNNKTNYNLVCETLQFLDIMCGSTTGGLGLLGLYINEDNVSLVIQTLETLTEYCQGPCHENQTCIVTHESNGIDIITALILNDISPLCKYRMDLVLQLKDNASKLLLALMESRHDSENAERILISLRPQELVDVIKKAYLQEEERENSEVSPREVGHNIYILALQLSRHNKQLQHLLKPVKRIQEEEAEGISSMLSLNNKQLSQMLKSSAPAQEEEEDPLAYYENHTSQIEIVRQDRSMEQIVFPVPGICQFLTEETKHRLFTTTEQDEQGSKVSDFFDQSSFLHNEMEWQRRLRSMPLIYWFSRRMTLWGSISFNLAVFINIIIAFFYPYVEGASTGVLGSPLISLLFWILICFSIAALFTKRYSVRPLIVALILRSIYYLGIGPTLNILGALNLTNKIVFVVSFVGNRGTFIRGYKAMVMDMEFLYHVGYILTSVLGLFAHELFYSILLFDLIYREETLFNVIKSVTRNGRSILLTALLALILVYLFSIVGFLFLKDDFILEVDRLPENHSRASTLGMPHGTATFVGTCSGDKIDCASEVSVPEILEVDEEPDSTERACDTLLMCIVTVMNHGLRNGGGVGDILRKPSKDESLFPARVVYDLLFFFVVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEEHIKLEHNMWNYLYFIVLVRVKNKTDYTGPESYVAQMIKNKNLDWFPRMRAMSLVSSEGEGEQNEIRILQEKLGSTMKLVSHLTAQLNELKEQVQLGPRGKMPPSPPDEIHLTQMTEQRKRRQRLGFVDVQNCISR sgmr1_mouse Sigma non-opioid intracellular receptor 1 Sigma 1-type opioid receptor Sigmar1 Oprs1 protein protein mouse Mus musculus Mouse MPWAAGRRWAWITLILTIIAVLIQAAWLWLGTQNFVFSREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCILHASLSEYVLLFGTALGSHGHSGRYWAEISDTIISGTFHQWKEGTTKSEVFYPGETVVHGPGEATALEWGPNTWMVEYGRGVIPSTLFFALADTFFSTQDYLTLFYTLRAYARGLRLELTTYLFGQDS oprs1-grp78-6 Interaction between Oprs1 and GRP78 identified by pull down 679887 N/A 679893 unspecified role unspecified role prey prey rat-brain Rattus norvegicus brain brain Brain [cerebrum] N/A 679894 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false Fig 4E oprs1-grp78-7 Interaction between Oprs1 and GRP78 identified by pull down 679887 N/A 679893 unspecified role unspecified role prey prey rat-pancreas Rattus norvegicus pancreas N/A 679894 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false Fig 4E oprs1-grp78-8 Interaction between Oprs1 and GRP78 identified by pull down 679887 N/A 679894 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) N/A 679893 unspecified role unspecified role prey prey rat-liver rattus norvegicus liver Rat liver liver physical association physical association false false false Fig 4E oprs1-grp78-9 Interaction between rat Oprs1 and hamster GRP78 identified by pull down 679887 N/A 679894 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) n/a 679895 unspecified role unspecified role prey prey crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association false false false Fig 4E, 4F Ca2+, Mn2+ oprs1-grp78-2 Interaction between Oprs1 and GRP78 identified by coimmunoprecipitation 679888 N/A 679896 unspecified role unspecified role bait bait n/a 679895 unspecified role unspecified role prey prey physical association physical association false false false Fig 2C oprs1-grp78-4 Interaction between Oprs1 and GRP78 identified by coimmunoprecipitation 679888 n/a 679895 unspecified role unspecified role bait bait N/A 679896 unspecified role unspecified role prey prey physical association physical association false false false Fig 2C oprs1-itpr3-1 Interaction between Oprs1 and Itpr3 identified by coimmunoprecipitation 679888 N/A 679896 unspecified role unspecified role bait bait N/A 679897 unspecified role unspecified role prey prey physical association physical association false false false Fig 6A oprs1-grp78-3 Interaction between murine Oprs1 and chinese hamster GRP78 identified by coimmunoprecipitation 679889 N/A 679898 unspecified role unspecified role bait bait eyfp c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 679895 unspecified role unspecified role prey prey physical association physical association false false false Mg2+/ATP Glucose deprivation Calcium chelator BAPTA Ca2+, Mn2+ Pentazocine SKF-10047 PRE-084; 2-(4-morpholino)ethyl 1-phenylcyclohexane-1-carboxylate hydrochloride Fluoxetine Cocaine (weak) Methamphetamine Pregnenolone sulphate Dehydroepiandrosterone sulphate NE-100; N ,N-dipropyl-2-[4-methoxy-3-(2-phenylethoxy)phenyl]-ethylamine monohydrochloride Figs. 2B, 2D, 2G, 2H, 3A, 3B, 3C oprs1-itpr3-2 Interaction between Oprs1 and Itpr3 identified by coimmunoprecipitation 679889 N/A 679896 unspecified role unspecified role bait bait eyfp c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 679897 unspecified role unspecified role prey prey physical association physical association false false false Fig 6A, 6D Thapsigargin (inhibitor of sarco-endoplasmic reticulum Ca2+-ATPases) BAPTA-AM - calcium chelator oprs1-itpr3-4 Interaction between Oprs1, Grp78 and Itpr3 identified by coimmunoprecipitation 679889 N/A 679896 unspecified role unspecified role bait bait eyfp c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 679897 unspecified role unspecified role prey prey n/a 679895 unspecified role unspecified role prey prey association association false false false Fig 6C ATP - inhibited binding of Gpr78 but not Itpr3 Thapsigargin (endoplasmic reticulum stress factor) BAPTA-AM calcium chelator oprs1-grp78-1 Interaction between murine Oprs1 and chinese hamster GRP78 identified by immunodepletion 679890 n/a 679895 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 679898 unspecified role unspecified role bait bait eyfp c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig 2A, S2E oprs1-hspa5-1 Interaction between murine Oprs1 and chinese hamster Hspa5 identified by immunopreciptiation 679891 n/a 679895 unspecified role unspecified role prey prey N/A 679898 unspecified role unspecified role bait bait eyfp c-terminal tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig 2F Oprs1 stably associates with Hspa5 over more than 32 hours oprs1-itpr3-3 Interaction between Oprs1 and Itpr3 identified by colocalization 679892 N/A 679896 unspecified role unspecified role neutral component neutral component N/A 679897 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig 6A