IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ schelhaas-2007-1 Simian Virus 40 Depends on ER Protein Folding and Quality Control Factors for Entry into Host Cells. chlae-cv-1 Monkey African Green kidney fibroblast Grivet cv-1 Monkey African Green kidney fibroblast solution sedimentati cosedimentation in solution solution sedimentati western blot western blot Immuno blot Immuno blot Schelhaas M., Malmstrom J., Pelkmans L., Haugstetter J., Ellgaard L., Grunewald K., Helenius A. Linear 5%-20% sucrose gradient ari.helenius@bc.biol.ethz.ch Cell (0092-8674) 2007 Only protein-protein interactions 2 imex curation vp1_sv40 Major capsid protein VP1 Major structural protein VP1 protein protein sv40 sv40 SV40 MAPTKRKGSCPGAAPKKPKEPVQVPKLVIKGGIEVLGVKTGVDSFTEVECFLNPQMGNPDEHQKGLSKSLAAEKQFTDDSPDKEQLPCYSVARIPLPNINEDLTCGNILMWEAVTVKTEVIGVTAMLNLHSGTQKTHENGAGKPIQGSNFHFFAVGGEPLELQGVLANYRTKYPAQTVTPKNATVDSQQMNTDHKAVLDKDNAYPVECWVPDPSKNENTRYFGTYTGGENVPPVLHITNTATTVLLDEQGVGPLCKADSLYVSAVDICGLFTNTSGTQQWKGLPRYFKITLRKRSVKNPYPISFLLSDLINRRTQRVDGQPMIGMSSQVEEVRVYEDTEELPGDPDMIRYIDEFGQTTTRMQ 81C28EB7EA51D398 p03093-2 Minor capsid protein VP2 Minor structural protein VP2 Minor capsid protein VP3 protein protein sv40 sv40 SV40 MAVDLYRPDDYYDILFPGVQTFVHSVQYLDPRHWGPTLFNAISQAFWRVIQNDIPRLTSQELERRTQRYLRDSLARFLEETTWTVINAPVNWYNSLQDYYSTLSPIRPTMVRQVANREGLQISFGHTYDNIDEADSIQQVTERWEAQSQSPNVQSGEFIEKFEAPGGANQRTAPQWMLPLLLGLYGSVTSALKAYEDGPNKKKRKLSRGSSQKTKGTSASAKARHKRRNRSSRS Produced by alternative initiation at Met-119 of isoform VP2. p03093-1 Minor capsid protein VP2 Minor structural protein VP2 Minor capsid protein VP2 protein protein sv40 sv40 SV40 MGAALTLLGDLIATVSEAAAATGFSVAEIAAGEAAAAIEVQLASVATVEGLTTSEAIAAIGLIPQAYAVISGAPAAIAGFAALLQTVTGVSAVAQVGYRFFSDWDHKVSTVGLYQQPGMAVDLYRPDDYYDILFPGVQTFVHSVQYLDPRHWGPTLFNAISQAFWRVIQNDIPRLTSQELERRTQRYLRDSLARFLEETTWTVINAPVNWYNSLQDYYSTLSPIRPTMVRQVANREGLQISFGHTYDNIDEADSIQQVTERWEAQSQSPNVQSGEFIEKFEAPGGANQRTAPQWMLPLLLGLYGSVTSALKAYEDGPNKKKRKLSRGSSQKTKGTSASAKARHKRRNRSSRS Produced by alternative splicing of the late mRNA (19s mRNA). vp1-vp1-1 Pentameric VP1 identified by density gradient centrifugation 679144 N/A 679145 unspecified role unspecified role neutral component neutral component Stoichiometry: 5.0 physical association physical association false false false Figure 6A Sedimentation coefficient = 250S Addition of reducing agents and chelating agents reduces interpentamer connections but not the stability of the pentamers vp1-vp2-1 Interactions between VP1, VP2 and VP3 identified by density gradient centrifugation 679144 N/A 679146 unspecified role unspecified role neutral component neutral component n/a 679147 unspecified role unspecified role neutral component neutral component N/A 679145 unspecified role unspecified role neutral component neutral component physical association physical association false false false Figure 6D