IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ marri-2007-2 Spontaneous assembly of photosynthetic supramolecular complexes as mediated by the intrinsically unstructured protein CP12. in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Marri L., Trost P., Trivelli X., Gonnelli L., Pupillo P., Sparla F. trost@alma.unibo.it J. Biol. Chem. (0021-9258) 2007 marri-2007-1 Spontaneous assembly of photosynthetic supramolecular complexes as mediated by the intrinsically unstructured protein CP12. in vitro In vitro light scattering light scattering predetermined predetermined participant predetermined Marri L., Trost P., Trivelli X., Gonnelli L., Pupillo P., Sparla F. trost@alma.unibo.it J. Biol. Chem. (0021-9258) 2007 marri-2007-3 Spontaneous assembly of photosynthetic supramolecular complexes as mediated by the intrinsically unstructured protein CP12. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Marri L., Trost P., Trivelli X., Gonnelli L., Pupillo P., Sparla F. trost@alma.unibo.it J. Biol. Chem. (0021-9258) 2007 cp122_arath Calvin cycle protein CP12-2, chloroplastic CP12-2 CP12 domain-containing protein 2 Chloroplast protein 12-2 T12C14.110 At3g62410 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATIATGLNIATQRVFVTSENRPVCLAGPVHLNNSWNLGSRTTNRMMKLQPIKAAPEGGISDVVEKSIKEAQETCAGDPVSGECVAAWDEVEELSAAASHARDKKKADGSDPLEEYCKDNPETNECRTYDN g3pa1_arath Glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic GAPA1 GAPA NADP-dependent glyceraldehydephosphate dehydrogenase A subunit 1 MLJ15.4 MLJ15_5 At3g26650 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASVTFSVPKGFTEFSGLRSSSASLPFGKKLSSDEFVSIVSFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDIIAINDTGGVKQASHLLKYDSTLGIFDADVKPSGETAISVDGKIIQVVSNRNPSLLPWKELGIDIVIEGTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK kppr_arath Phosphoribulokinase, chloroplastic Phosphopentokinase At1g32060 T12O21.4 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAVSTIYSTQALNSTHFLTSSSSSKQVFLYRRQPQTNRRFNTLITCAQETIVIGLAADSGCGKSTFMRRLTSVFGGAAKPPKGGNPDSNTLISDTTTVICLDDYHSLDRYGRKEQKVTALDPRANDFDLMYEQVKALKNGIAVEKPIYNHVTGLLDPPELIQPPKILVIEGLHPMFDERVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAFIDPQKQYADAVIEVLPTTLIPDDNEGKVLRVRLIMKEGVKYFSPVYLFDEGSTISWIPCGRKLTCSYPGIKFNYEPDSYFDHEVSVLEMDGQFDRLDELIYVESHLSNLSTKFYGEVTQQMLKHADFPGSNNGTGLFQTIVGLKIRDLYEQLIANKATARAEAKA cp12-gapdh-1 Interaction of CP12 and GAPDH 678664 N/A 678667 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) Stoichiometry: 2.0 N/A 678668 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) Stoichiometry: 4.0 direct interaction direct interaction false false false 3 K0 = 0.18 +/- 0.02 micro moles Gibbs free energy of interaction -9.4 kcal per mole Interaction was found to be exoergonic overall. cp12-gapdh--prk Interaction of CP12 , GAPDH and PRK 678664 N/A 678669 unspecified role unspecified role neutral component neutral component N/A 678668 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) Stoichiometry: 4.0 N/A 678667 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) Stoichiometry: 2.0 direct interaction direct interaction false false false 4 K0 = 0.17 +/- 0.09 micro moles Gibbs free energy of interaction -9.3 kcal per mole Thermodynamic parameters indicated that ternary complex assembly was largely exothermic. cp12-gapdh Interaction of CP12 and GAPDH 678665 N/A 678667 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) Stoichiometry: 2.0 N/A 678668 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false Table 1 cp12-gapdh-2 Interaction of CP12 and GAPDH 678666 N/A 678667 unspecified role unspecified role neutral component neutral component Q9LZP9:p.Cys126Ser mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false ecobb Escherichia coli (strain B / BL21) Stoichiometry: 2.0 N/A 678668 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) Stoichiometry: 4.0 direct interaction direct interaction false false false 5