IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ sawa-2007-1 FKF1 and GIGANTEA complex formation is required for day-length measurement in Arabidopsis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Sawa M., Nusinow DA., Kay SA., Imaizumi T. Transgenic arabidopsis plants Colombia-0 (Col-0) ecotype expressing epitope tagged GI and FKF1 proteins were used in this study. Assays were carried out on 10 day old seedlings which were grown under short day (8 hours light/16 dark) or long day (16 hours light/8 hours dark) conditions and sampling was carried out under dim green safe light. takato@scripps.edu Science (0036-8075) 2007 Only protein-protein interactions imex curation sawa-2007-6 FKF1 and GIGANTEA complex formation is required for day-length measurement in Arabidopsis. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Sawa M., Nusinow DA., Kay SA., Imaizumi T. Transgenic arabidopsis plants Colombia-0 (Col-0) ecotype expressing epitope tagged GI and FKF1 proteins were used in this study. Assays were carried out on 10 day old seedlings which were grown under short day (8 hours light/16 dark) or long day (16 hours light/8 hours dark) conditions and sampling was carried out under dim green safe light. takato@scripps.edu Science (0036-8075) 2007 Only protein-protein interactions imex curation sawa-2007-2 FKF1 and GIGANTEA complex formation is required for day-length measurement in Arabidopsis. arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sawa M., Nusinow DA., Kay SA., Imaizumi T. Transgenic arabidopsis plants Colombia-0 (Col-0) ecotype expressing epitope tagged GI and FKF1 proteins were used in this study. Assays were carried out on 10 day old seedlings which were grown under short day (8 hours light/16 dark) or long day (16 hours light/8 hours dark) conditions and sampling was carried out under dim green safe light. takato@scripps.edu Science (0036-8075) 2007 Only protein-protein interactions imex curation sawa-2007-3 FKF1 and GIGANTEA complex formation is required for day-length measurement in Arabidopsis. arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sawa M., Nusinow DA., Kay SA., Imaizumi T. Transgenic arabidopsis plants Colombia-0 (Col-0) ecotype expressing epitope tagged GI and FKF1 proteins were used in this study. Assays were carried out on 10 day old seedlings which were grown under short day (8 hours light/16 dark) or long day (16 hours light/8 hours dark) conditions and sampling was carried out under dim green safe light. takato@scripps.edu Science (0036-8075) 2007 Only protein-protein interactions imex curation sawa-2007-4 FKF1 and GIGANTEA complex formation is required for day-length measurement in Arabidopsis. arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sawa M., Nusinow DA., Kay SA., Imaizumi T. Transgenic arabidopsis plants Colombia-0 (Col-0) ecotype expressing epitope tagged GI and FKF1 proteins were used in this study. Assays were carried out on 10 day old seedlings which were grown under short day (8 hours light/16 dark) or long day (16 hours light/8 hours dark) conditions and sampling was carried out under dim green safe light. takato@scripps.edu Science (0036-8075) 2007 Only protein-protein interactions imex curation sawa-2007-5 FKF1 and GIGANTEA complex formation is required for day-length measurement in Arabidopsis. arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sawa M., Nusinow DA., Kay SA., Imaizumi T. Transgenic arabidopsis plants Colombia-0 (Col-0) ecotype expressing epitope tagged GI and FKF1 proteins were used in this study. Assays were carried out on 10 day old seedlings which were grown under short day (8 hours light/16 dark) or long day (16 hours light/8 hours dark) conditions and sampling was carried out under dim green safe light. takato@scripps.edu Science (0036-8075) 2007 Only protein-protein interactions imex curation sawa-2007-7 FKF1 and GIGANTEA complex formation is required for day-length measurement in Arabidopsis. arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sawa M., Nusinow DA., Kay SA., Imaizumi T. Transgenic arabidopsis plants Colombia-0 (Col-0) ecotype expressing epitope tagged GI and FKF1 proteins were used in this study. Assays were carried out on 10 day old seedlings which were grown under short day (8 hours light/16 dark) or long day (16 hours light/8 hours dark) conditions and sampling was carried out under dim green safe light. takato@scripps.edu Science (0036-8075) 2007 Only protein-protein interactions imex curation sawa-2007-8 FKF1 and GIGANTEA complex formation is required for day-length measurement in Arabidopsis. arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sawa M., Nusinow DA., Kay SA., Imaizumi T. Transgenic arabidopsis plants Colombia-0 (Col-0) ecotype expressing epitope tagged GI and FKF1 proteins were used in this study. Assays were carried out on 10 day old seedlings which were grown under short day (8 hours light/16 dark) or long day (16 hours light/8 hours dark) conditions and sampling was carried out under dim green safe light. takato@scripps.edu Science (0036-8075) 2007 Only protein-protein interactions imex curation gigan_arath Protein GIGANTEA GI At1g22770 T22J18.6 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASSSSSERWIDGLQFSSLLWPPPRDPQQHKDQVVAYVEYFGQFTSEQFPDDIAELVRHQYPSTEKRLLDDVLAMFVLHHPEHGHAVILPIISCLIDGSLVYSKEAHPFASFISLVCPSSENDYSEQWALACGEILRILTHYNRPIYKTEQQNGDTERNCLSKATTSGSPTSEPKAGSPTQHERKPLRPLSPWISDILLAAPLGIRSDYFRWCSGVMGKYAAGELKPPTIASRGSGKHPQLMPSTPRWAVANGAGVILSVCDDEVARYETATLTAVAVPALLLPPPTTSLDEHLVAGLPALEPYARLFHRYYAIATPSATQRLLLGLLEAPPSWAPDALDAAVQLVELLRAAEDYASGVRLPRNWMHLHFLRAIGIAMSMRAGVAADAAAALLFRILSQPALLFPPLSQVEGVEIQHAPIGGYSSNYRKQIEVPAAEATIEATAQGIASMLCAHGPEVEWRICTIWEAAYGLIPLNSSAVDLPEIIVATPLQPPILSWNLYIPLLKVLEYLPRGSPSEACLMKIFVATVETILSRTFPPESSRELTRKARSSFTTRSATKNLAMSELRAMVHALFLESCAGVELASRLLFVVLTVCVSHEAQSSGSKRPRSEYASTTENIEANQPVSNNQTANRKSRNVKGQGPVAAFDSYVLAAVCALACEVQLYPMISGGGNFSNSAVAGTITKPVKINGSSKEYGAGIDSAISHTRRILAILEALFSLKPSSVGTPWSYSSSEIVAAAMVAAHISELFRRSKALTHALSGLMRCKWDKEIHKRASSLYNLIDVHSKVVASIVDKAEPLEAYLKNTPVQKDSVTCLNWKQENTCASTTCFDTAVTSASRTEMNPRGNHKYARHSDEGSGRPSEKGIKDFLLDASDLANFLTADRLAGFYCGTQKLLRSVLAEKPELSFSVVSLLWHKLIAAPEIQPTAESTSAQQGWRQVVDALCNVVSATPAKAAAAVVLQAERELQPWIAKDDEEGQKMWKINQRIVKVLVELMRNHDRPESLVILASASDLLLRATDGMLVDGEACTLPQLELLEATARAIQPVLAWGPSGLAVVDGLSNLLKCRLPATIRCLSHPSAHVRALSTSVLRDIMNQSSIPIKVTPKLPTTEKNGMNSPSYRFFNAASIDWKADIQNCLNWEAHSLLSTTMPTQFLDTAARELGCTISLSQ ado3_arath Adagio protein 3 ADO3 Flavin-binding kelch repeat F-box protein 1 F-box only protein 2a At1g68050 FKF1 T23K23.10 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAREHAIGEATGKRKKRGRVEEAEEYCNDGIEEQVEDEKLPLEVGMFYYPMTPPSFIVSDALEPDFPLIYVNRVFEVFTGYRADEVLGRNCRFLQYRDPRAQRRHPLVDPVVVSEIRRCLEEGIEFQGELLNFRKDGTPLVNRLRLAPIRDDDGTITHVIGIQVFSETTIDLDRVSYPVFKHKQQLDQTSECLFPSGSPRFKEHHEDFCGILQLSDEVLAHNILSRLTPRDVASIGSACRRLRQLTKNESVRKMVCQNAWGKEITGTLEIMTKKLRWGRLARELTTLEAVCWRKFTVGGIVQPSRCNFSACAVGNRLVLFGGEGVNMQPLDDTFVLNLDAECPEWQRVRVTSSPPGRWGHTLSCLNGSWLVVFGGCGRQGLLNDVFVLDLDAKHPTWKEVAGGTPPLPRSWHSSCTIEGSKLVVSGGCTDAGVLLSDTFLLDLTTDKPTWKEIPTSWAPPSRLGHSLSVFGRTKILMFGGLANSGHLKLRSGEAYTIDLEDEEPRWRELECSAFPGVVVPPPRLDHVAVSMPCGRVIIFGGSIAGLHSPSQLFLIDPAEEKPSWRILNVPGKPPKLAWGHSTCVVGGTRVLVLGGHTGEEWILNELHELCLASRQDSDL srk2g_arath Serine/threonine-protein kinase SRK2G SRK2G At5g08590 MAH20.15 ASK2 OSKL8 SNRK2.1 Arabidopsis protein SK1 OST1-kinase-like 8 SNF1-related kinase 2.1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDKYDVVKDLGAGNFGVARLLRHKDTKELVAMKYIERGRKIDENVAREIINHRSLKHPNIIRFKEVILTPTHLAIVMEYASGGELFDRICTAGRFSEAEARYFFQQLICGVDYCHSLQICHRDLKLENTLLDGSPAPLLKICDFGYSKSSILHSRPKSTVGTPAYIAPEVLSRREYDGKHADVWSCGVTLYVMLVGAYPFEDPNDPKNFRKTIQRIMAVQYKIPDYVHISQECKHLLSRIFVTNSAKRITLKEIKNHPWYLKNLPKELLESAQAAYYKRDTSFSLQSVEDIMKIVGEARNPAPSTSAVKSSGSGADEEEEEDVEAEVEEEEDDEDEYEKHVKEAQSCQESDKA cdf1_arath Cyclic dof factor 1 CDF1 DOF5.5 Dof zinc finger protein DOF5.5 K19B1.4 MMI9.24 At5g62430 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MLETKDPAIKLFGMKIPFPTVLEVADEEEEKNQNKTLTDQSEKDKTLKKPTKILPCPRCNSMETKFCYYNNYNVNQPRHFCKACQRYWTSGGTMRSVPIGAGRRKNKNNSPTSHYHHVTISETNGPVLSFSLGDDQKVSSNRFGNQKLVARIENNDERSNNNTSNGLNCFPGVSWPYTWNPAFYPVYPYWSMPVLSSPVSSSPTSTLGKHSRDEDETVKQKQRNGSVLVPKTLRIDDPNEAAKSSIWTTLGIKNEVMFNGFGSKKEVKLSNKEETETSLVLCANPAALSRSINFHEQM fkf1-gi-3 Interaction between FKF1 protein and Gigantea protein 668531 N/A 668539 unspecified role unspecified role prey prey N/A 668540 unspecified role unspecified role bait bait n-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1A fkf1-ask2 Interaction between FKF1 protein and ASK2 protein 668531 N/A 668540 unspecified role unspecified role bait bait N/A 668541 unspecified role unspecified role prey prey physical association physical association false false false 1A cdf1-gi Interaction between CDF1 protein and GIGANTEA protein 668531 N/A 668539 unspecified role unspecified role bait bait n terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 668542 unspecified role unspecified role prey prey physical association physical association false false false S10 fkf1-gi-8 Interaction between FKF1 protein and Gigantea protein 668532 N/A 668540 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q9C9W9:p.Cys91Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q9C9W9:p.Arg92Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q9C9W9:p.Gln163Leu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false N/A 668539 unspecified role unspecified role bait bait n terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false 1G S3 white light The interaction appeared to be light dependent and mediated through the region 91 to 163 since mutations in amino acids withing this region decreased interaction level to that observed in dark grown plants or abolished interaction completely. cdf1-gi-1 Interaction between CDF1 protein and GIGANTEA protein 668532 N/A 668539 unspecified role unspecified role bait bait n terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 668542 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false S10 fkf1-gi-4 Interaction between FKF1 protein and Gigantea protein 668533 N/A 668540 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 668539 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1B 1C The authors note that "In both day-length conditions, the amount of coimmunoprecipitated HA-FKF1 protein increased until 4 hours after light onset, remained constant for the rest of day, and declined in the dark (Fig. 1, B and C), suggesting that light or the circadian clock modulate the FKF1 and GI interaction.". fkf1-gi-5 Interaction between FKF1 protein and Gigantea protein 668534 N/A 668539 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 668540 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false S2 white light The minimal amount of coimmunoprecipitated proetins in dark grown material and subseqeunt increase when the dark grown plants were exposed to light indicated that this interaction is light dependent. fkf1-gi-6 Interaction between FKF1 protein and Gigantea protein 668535 N/A 668540 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 668539 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1E blue light the authors concluded that "blue light induces this interaction". fkf1-gi-7 Interaction between FKF1 protein and Gigantea protein 668536 N/A 668539 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 668540 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1F blue light There seemed to be a direct correlation between increasing fluence of blue light and affinity of the GI protein for the FKF1 protein. fkf1-gi-9 Interaction between FKF1 protein and Gigantea protein 668537 N/A 668539 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 668540 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 2 In long days HA-FKF1 and GI-TAP interaction was observed in after 10 hours after the light period began. In short days the FKF1 and GI interaction occurred only at the beginning of the FKF1 expression period at 7 hours after the light period began. gi-cdf1-1 Interaction between GIGANTEA protein and CDF1 protein 668538 N/A 668542 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 668539 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3A