DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ martin-2007-1 Protection of telomeres by a conserved Stn1-Ten1 complex. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Martin V., Du LL., Rozenzhak S., Russell P. Experiment was performed in a taz1 deletion strain, which has elongated telomeres. prussell@scripps.edu Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2007 IMEx Only protein-protein interactions imex curation martin-2007-2 Protection of telomeres by a conserved Stn1-Ten1 complex. schpm Schizosaccharomyces pombe (fission yeast) Fission yeast fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Martin V., Du LL., Rozenzhak S., Russell P. Experiment was performed in a taz1 deletion strain, which has elongated telomeres. prussell@scripps.edu Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2007 IMEx Only protein-protein interactions imex curation pot1_schpo Protection of telomeres protein 1 pot1 SPAC26H5.06 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MGEDVIDSLQLNELLNAGEYKIGELTFQSIRSSQELQKKNTIVNLFGIVKDFTPSRQSLHGTKDWVTTVYLWDPTCDTSSIGLQIHLFSKQGNDLPVIKQVGQPLLLHQITLRSYRDRTQGLSKDQFRYALWPDFSSNSKDTLCPQPMPRLMKTGDKEEQFALLLNKIWDEQTNKHKNGELLSTSSARQNQTGLSYPSVSFSLLSQITPHQRCSFYAQVIKTWYSDKNFTLYVTDYTENELFFPMSPYTSSSRWRGPFGRFSIRCILWDEHDFYCRNYIKEGDYVVMKNVRTKIDHLGYLECILHGDSAKRYNMSIEKVDSEEPELNEIKSRKRLYVQNCQNGIEAVIEKLSQSQQSENPFIAHELKQTSVNEITAHVINEPASLKLTTISTILHAPLQNLLKPRKHRLRVQVVDFWPKSLTQFAVLSQPPSSYVWMFALLVRDVSNVTLPVIFFDSDAAELINSSKIQPCNLADHPQMTLQLKERLFLIWGNLEERIQHHISKGESPTLAAEDVETPWFDIYVKEYIPVIGNTKDHQSLTFLQKRWRGFGTKIV stn1_schpo Protein stn1 stn1 SPBC409.12c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MLENENQLTHQFPTLSRWNPMFISDVHKISFHPHLQRYIGFWMGFPIRWIQIVGYIAAIDIYEGKHVLTVDDCSGMVLRVVFIIQDDFSMSKRAISMSPGNVVCVFGKINSFRSEVELIAQSFEELRDPNDEWKAWQKRMRYKKNLTKISKNHHSIIRTPKKSYFPKDHAKELLKCIRQMCKLNVQAGFTIEELIIYLKAKELHLPLVHIFNVENEIVENCDGNHILALNFSLQTLLQHGRIVRKSNSVYMLVTSKDIIRFVIPLMASGLLEAHKVQSIVRDSNPMFITLPLSAIAKHICQFLLRTKGKWRQAKKYTWVRDNQFV ten1_schpo Protein ten1 ten1 SPCC1393.14 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MDSAKLIFINQINDCKDGQKLRFLGCVQSYKNGILRLIDGSSSVTCDVTVVLPDVSIQKHEWLNIVGRKRQDGIVDVLLIRSAVGINLPRYRQMVSERQKCD pot1-pot1-1 678396 N/A 678398 unspecified role unspecified role bait bait N/A 678398 unspecified role unspecified role prey prey physical association physical association false false false Fig.3E stn1-ten1-3 678396 N/A 678399 unspecified role unspecified role bait bait N/A 678400 unspecified role unspecified role prey prey physical association physical association false false false Fig.3E ten1-stn1-6 678396 N/A 678400 unspecified role unspecified role bait bait N/A 678399 unspecified role unspecified role prey prey physical association physical association false false false Fig.3E stn1-pot1-1 678397 N/A 678399 unspecified role unspecified role neutral component neutral component c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 678398 unspecified role unspecified role neutral component neutral component c-terminus cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Fig.4B ten1-pot1-1 678397 N/A 678400 unspecified role unspecified role neutral component neutral component c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 678398 unspecified role unspecified role neutral component neutral component c-terminus cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Fig.4B