MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint monie-2007-1 Structural insights into the transcriptional and translational roles of Ebp1. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Monie TP., Perrin AJ., Birtley JR., Sweeney TR., Karakasiliotis I., Chaudhry Y., Roberts LO., Matthews S., Goodfellow IG., Curry S. EMBO J. (0261-4189) 2007 Only protein-protein interactions imex curation pa2g4_mouse Proliferation-associated protein 2G4 Ebp1 Pa2g4 Plfap Proliferation-associated protein 1 Protein p38-2G4 Mpp1 IRES-specific cellular trans-acting factor 45 kDa protein protein mouse Mus musculus Mouse MSGEDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKIFKKEKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVAHTFVIGVAQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQRTTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALLQSSASRKTQKKKKKKASKTVENATSGETLEENGAGD mint May play a role in a ERBB3-regulated signal transduction pathway. Seems be involved in growth regulation. Acts a corepressor of the androgen receptor (AR) and is regulated by the ERBB3 ligand neuregulin-1/heregulin (HRG). Inhibits transcription of some E2F1-regulated promoters, probably by recruiting histone acetylase (HAT) activity. Binds RNA. Associates with 28S, 18S and 5.8S mature rRNAs, several rRNA precursors and probably U3 small nucleolar RNA. May be involved in regulation of intermediate and late steps of rRNA processing. May be involved in ribosome assembly (By similarity). Mediates cap-independent translation of specific viral IRESs (internal ribosomal entry site). Together with PTBP1 is required for the translation initiation on the foot-and-mouth disease virus (FMDV) IRES sxl_drome Protein sex-lethal Sxl Sx1 CG43770 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MYGNNNPGSNNNNGGYPPYGYNNKSSGGRGFGMSHSLPSGMSRYAFSPQDTEFSFPSSSSRRGYNDFPGCGGSGGNGGSANNLGGGNMCHLPPMASNNSLNNLCGLSLGSGGSDDLMNDPRASNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSFGYAFVDFTSEMDSQRAIKVLNGITVRNKRLKVSYARPGGESIKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNNVIPEGGSQPLSVRLAEEHGKAKAAHFMSQMGVVPANVPPPPPQPPAHMAAAFNMMHRGRSIKSQQRFQNSHPYFDAKKFI ravr1_mouse Ribonucleoprotein PTB-binding 1 Protein raver-1 Raver1 Kiaa1978 protein protein mouse Mus musculus Mouse MAADVSVTHRPPLSPEAEAEAETPETVDRRAPEQELPPLDPEEIRKRLEHTERQFRNRRKILIRGLPGDVTNQEVHDLLSDYELKYCFVDKYKGTAFVTLLNGEQAEAAINTFHQSRLRERELSVQLQPTDALLCVANLPPSLTQAQFEELVRPFGSLERCFLVYSERTGHSKGYGFAEYMKKDSAARAKSDLLGKPLGPRTLYVHWTDAGQLTPALLHSRCLCVDHLPPGFSDVDALRRALSVVYTPTFCQLACGQDGQLKGFAVLEYETAEMAEAAQERADGQALGDSHLRVSFCAPGPPGRSMLAALIAAQATALNRGKGLLPEPNLLQLLNNLGPSASLQLLLNPLLHGGASGKQGLLGAPPAMPLLSGPALSTALLQLALQSQSQNQSQGQKKPGILGDSPLGTLQAGAQPSNSLLGELSAGGGLAPELPPRRGKPQPLLPPLLGPSGGDREPMGLGPPATQLTPPPAPVGLRGSNHRGLPKDSGPLPTPPGVSLLGEPPKDYRIPLNPYLNLHSLLPSSNLAGKETRGWGGSGRGRRPAEPPLPSPAVPGGGSGSNNGNKAFQMKSRLLSPIASNRLPPEPGLPDSYGFDYPTDVGPRRLFSHPREPTLGAHGPSRHKMSPPPSSFNEPRSGGGSGGPLSHFYSGSPTSYFTSGLQAGLKQSHLNKAVGSSPMGSSEGLLGLGPGPNGHSHLLKTPLGGQKRSFSHLLPSPEPSPEGSYVGQHSQGLGGHYADSYLKRKRIF ptbp1_mouse Polypyrimidine tract-binding protein 1 Ptbp1 Ptb Heterogeneous nuclear ribonucleoprotein I protein protein mouse Mus musculus Mouse MDGIVPDIAVGTKRGSDELFSTCVSNGPFIMSSSASAANGNDSKKFKGDNRSAGVPSRVIHVRKLPSDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIEMNTEEAANTMVNYYTSVAPVLRGQPIYIQFSNHKELKTDSSPNQVRAQAALQAVNSVQSGNLALAASAAAVDAGMAMAGQSPVLRIIVENLFYPVTLDVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPVSAQHAKLSLDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDYTRPDLPSGDSQPSLDQTMAAAFGLSVPNVHGALAPLAIPSAAAAAAASRIAIPGLAGAGNSVLLVSNLNPERVTPQSLFILFGVYGDVQRVKILFNKKENALVQMADGSQAQLGEPPERAQAAREVSAHYTVQASECAAAREGQEDQGLTKDYGSSPLRFKKPGSKNFQNIFPPSATLHLSNIPPSVSEDDLKSLFSSNGGVVKGFKFFQKDRKMALIQMGSVEEAVQALIELHNHDLGENHHLRVSFSKSTI mint Plays a role in pre-mRNA splicing. Binds to the polypyrimidine tract of introns. May promote the binding of U2 snRNP to pre-mRNA. Cooperates with RAVER1 to modulate switching between mutually exclusive exons during maturation of the TPM1 pre-mRNA sxl-pa2g4 680460 pa2g4_mouse Ebp1 680461 predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false sxl_drome Sxl 680462 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F3 mint sxl-raver1 680460 sxl_drome Sxl 680462 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ravr1_mouse Raver1 680463 predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false F3 mint ptbp1-pa2g4 680460 pa2g4_mouse Ebp1 680461 predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ptbp1_mouse PTB 680464 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F3 mint ptbp1-raver1 680460 ptbp1_mouse PTB 680464 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ravr1_mouse Raver1 680463 predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated physical association physical association false false false F3 mint