IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ weart-2007-3 A metabolic sensor governing cell size in bacteria. bacsu Bacillus subtilis electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy predetermined predetermined participant predetermined Weart RB., Lee AH., Chien AC., Haeusser DP., Hill NS., Levin PA. The UgtP was labelled with Thioredoxin and 6XHis to create a Thioredoxin-UgtP-6XHis fusion protein. plevin@biology.wustl.edu Cell (0092-8674) 2007 Only protein-protein interactions 7 imex curation weart-2007-2 A metabolic sensor governing cell size in bacteria. in vitro In vitro light scattering light scattering predetermined predetermined participant predetermined Weart RB., Lee AH., Chien AC., Haeusser DP., Hill NS., Levin PA. The UgtP was labelled with Thioredoxin and 6XHis to create a Thioredoxin-UgtP-6XHis fusion protein. plevin@biology.wustl.edu Cell (0092-8674) 2007 Only protein-protein interactions 7 imex curation weart-2007-1 A metabolic sensor governing cell size in bacteria. bacsu Bacillus subtilis fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Weart RB., Lee AH., Chien AC., Haeusser DP., Hill NS., Levin PA. plevin@biology.wustl.edu Cell (0092-8674) 2007 Only protein-protein interactions 7 imex curation ftsz_bacsu Cell division protein FtsZ ftsZ BSU15290 protein protein bacsu Bacillus subtilis MLEFETNIDGLASIKVIGVGGGGNNAVNRMIENEVQGVEYIAVNTDAQALNLSKAEVKMQIGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQIAKDLGALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNTPMLEAFREADNVLRQGVQGISDLIATPGLINLDFADVKTIMSNKGSALMGIGIATGENRAAEAAKKAISSPLLEAAIDGAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINENLKDEIVVTVIATGFIEQEKDVTKPQRPSLNQSIKTHNQSVPKREPKREEPQQQNTVSRHTSQPADDTLDIPTFLRNRNKRG ugtp_bacsu Processive diacylglycerol beta-glucosyltransferase UDP glucosyltransferase UDP-glucose:1,2-diacylglycerol-3-beta-D-glucosyltransferase Beta-gentiobiosyldiacylglycerol synthase ugtP ypfP BSU21920 Beta-diglucosyldiacylglycerol synthase Beta-monoglucosyldiacylglycerol synthase Beta-triglucosyldiacylglycerol synthase Glucosyl-beta-1,6-glucosyldiacylglycerol synthase Diglucosyl diacylglycerol synthase (1,6-linking) protein protein bacsu Bacillus subtilis MNTNKRVLILTANYGNGHVQVAKTLYEQCVRLGFQHVTVSNLYQESNPIVSEVTQYLYLKSFSIGKQFYRLFYYGVDKIYNKRKFNIYFKMGNKRLGELVDEHQPDIIINTFPMIVVPEYRRRTGRVIPTFNVMTDFCLHKIWVHENVDKYYVATDYVKEKLLEIGTHPSNVKITGIPIRPQFEESMPVGPIYKKYNLSPNKKVLLIMAGAHGVLKNVKELCENLVKDDQVQVVVVCGKNTALKESLSALEAENGDKLKVLGYVERIDELFRITDCMITKPGGITLTEATAIGVPVILYKPVPGQEKENANFFEDRGAAIVVNRHEEILESVTSLLADEDTLHRMKKNIKDLHLANSSEVILEDILKESEMMTAKQKAKVLS ezra_bacsu Septation ring formation regulator EzrA ezrA ytwP BSU29610 protein protein bacsu Bacillus subtilis MEFVIGLLIVLLALFAAGYFFRKKIYAEIDRLESWKIEILNRSIVEEMSKIKHLKMTGQTEEFFEKWREEWDEIVTAHMPKVEELLYDAEENADKYRFKKANQVLVHIDDLLTAAESSIEKILREISDLVTSEEKSREEIEQVRERYSKSRKNLLAYSHLYGELYDSLEKDLDEIWSGIKQFEEETEGGNYITARKVLLEQDRNLERLQSYIDDVPKLLADCKQTVPGQIAKLKDGYGEMKEKGYKLEHIQLDKELENLSNQLKRAEHVLMTELDIDEASAILQLIDENIQSVYQQLEGEVEAGQSVLSKMPELIIAYDKLKEEKEHTKAETELVKESYRLTAGELGKQQAFEKRLDEIGKLLSSVKDKLDAEHVAYSLLVEEVASIEKQIEEVKKEHAEYRENLQALRKEELQARETLSNLKKTISETARLLKTSNIPGIPSHIQEMLENAHHHIQETVNQLNELPLNMEEAGAHLKQAEDIVNRASRESEELVEQVILIEKIIQFGNRFRSQNHILSEQLKEAERRFYAFDYDDSYEIAAAAVEKAAPGAVEKIKADISA ftsza-ftsza-2 Electron microscopy showing assembly of FtsZ protofilaments in-vitro. 683680 N/A 683683 unspecified role unspecified role neutral component neutral component in vitro In vitro N/A 683683 unspecified role unspecified role neutral component neutral component in vitro In vitro physical association physical association false false false Figure 3 E FtsZ protofilaments were shown to assemble in-vitro. ftsza-ftsza-3 Electron microscopy to show the inhibition of FtsZ assembly in-vitro by UgtP. 683680 N/A 683684 inhibitor inhibitor neutral component neutral component in vitro In vitro N/A 683683 unspecified role unspecified role neutral component neutral component in vitro In vitro physical association physical association false false false Figure 3 F Thio-Ugtp was able to inhibit FtsZ assembly in-vitro at a ratio of 1:2, as only short polymers were present with little bundling observed. The participant EBI-1569853(P17865) was duplicated. It is posssible that originally this interaction did contain more participants pointing to different Trembl proteins which have been merged to a single swissprot protein later. ugtp-ugtp Electron microscopy to show UgtP assembly in-vitro. 683680 N/A 683684 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false thioredoxin fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 683684 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false thioredoxin fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false Figure 3G, 3H UgtP itself was able to form higher order structures in FtsZ assembly buffer (Figures 3G and 3H). ugtp-ugtp-1 Electron microscopy to show UgtP assembly in-vitro inhibited by FtsZ. 683680 N/A 683683 inhibitor inhibitor neutral component neutral component in vitro In vitro N/A 683684 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false thioredoxin fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false Figure 3F, 3G UgtP's ablility to to inhibit FtsZ assembly in-vitro occurs at the expence of UgtP self-assembly. The participant EBI-1567571(P54166) was duplicated. It is posssible that originally this interaction did contain more participants pointing to different Trembl proteins which have been merged to a single swissprot protein later. ftsza-ftsza Light scattering assay to show the inhibition of FtsZ assembly in-vitro by UgtP. 683681 N/A 683683 unspecified role unspecified role neutral component neutral component in vitro In vitro N/A 683684 inhibitor inhibitor neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false thioredoxin fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false Figure 3 A-D Thio-Ugtp was able to directly inhibit FtsZ assembly in-vitro at ratios as low as 1:5. The participant EBI-1569853(P17865) was duplicated. It is posssible that originally this interaction did contain more participants pointing to different Trembl proteins which have been merged to a single swissprot protein later. ftsza-ftsza-1 Light scattering assay to show assembly of FtsZ protofilaments in-vitro. 683681 N/A 683683 unspecified role unspecified role neutral component neutral component in vitro In vitro N/A 683683 unspecified role unspecified role neutral component neutral component in vitro In vitro physical association physical association false false false Figure 3 A-D FtsZ protofilaments were shown to assemble in-vitro. ugtp-ezra Colocalization showing interaction between ugtp and ezra in wt bacsu 683682 N/A 683684 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bacsu Bacillus subtilis N/A 683685 unspecified role unspecified role neutral component neutral component region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bacsu Bacillus subtilis colocalization colocalization false false false 4D