MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint dutertre-2007-1 AChBP-targeted alpha-conotoxin correlates distinct binding orientations with nAChR subtype selectivity. in vitro In vitro competition binding competition binding predetermined predetermined participant predetermined Dutertre S., Ulens C., Büttner R., Fish A., van Elk R., Kendel Y., Hopping G., Alewood PF., Schroeder C., Nicke A., Smit AB., Sixma TK., Lewis RJ. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation dutertre-2007-2 AChBP-targeted alpha-conotoxin correlates distinct binding orientations with nAChR subtype selectivity. in vitro In vitro saturation binding saturation binding predetermined predetermined participant predetermined Dutertre S., Ulens C., Büttner R., Fish A., van Elk R., Kendel Y., Hopping G., Alewood PF., Schroeder C., Nicke A., Smit AB., Sixma TK., Lewis RJ. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation ca11_conte Alpha-conotoxin-like Tx1 protein protein conte Conus textile MGMRMMFVVFLLVVLASTVVSSTSGRRAFHGRNAAAKASGLVSLTDRRPECCSDPRCNSSHPELCGGRR mint Alpha-conotoxins act on postsynaptic membranes, they bind to the nicotinic acetylcholine receptors (nAChR) and thus inhibit them achp_lymst Acetylcholine-binding protein protein protein lymst Lymnaea stagnalis Helix stagnalis MRRNIFCLACLWIVQACLSLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL mint Binds to acetylcholine. Modulates neuronal synaptic transmission 3l21a_bunmu Alpha-bungarotoxin Long neurotoxin 1 Alpha-bungarotoxin, isoform A31 Alpha-elapitoxin-Bm2a protein protein bunmu Bungarus multicinctus Many-banded krait MKTLLLTLVVVTIVCLDLGYTIVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG mint Produces peripheral paralysis by blocking neuromuscular transmission at the postsynaptic site. Binds to muscular and neuronal (alpha-7, alpha-8, and alpha-9) nicotinic acetylcholine receptors. Blocks the extracellular increase of dopamine evoked by nicotine only at the higher dose (4.2 uM) achp-cax1 680109 cax1_conte conotoxin 1a 680111 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified achp_lymst AChBP 680112 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false f1d mint achp-nxl1a 680110 nxl1a_bunmu bungarotoxin 680113 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified achp_lymst aChBP 680112 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false f1c kd 3.5 nanomolar mint