MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint ostendorp-2007-1 Structural and functional insights into RAGE activation by multimeric S100B. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Ostendorp T., Leclerc E., Galichet A., Koch M., Demling N., Weigle B., Heizmann CW., Kroneck PM., Fritz G. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation ostendor-2007-2 Structural and functional insights into RAGE activation by multimeric S100B. in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Ostendorp T., Leclerc E., Galichet A., Koch M., Demling N., Weigle B., Heizmann CW., Kroneck PM., Fritz G. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation ostendor-2007-5 Structural and functional insights into RAGE activation by multimeric S100B. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Ostendorp T., Leclerc E., Galichet A., Koch M., Demling N., Weigle B., Heizmann CW., Kroneck PM., Fritz G. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation ostendor-2007-1 Structural and functional insights into RAGE activation by multimeric S100B. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ostendorp T., Leclerc E., Galichet A., Koch M., Demling N., Weigle B., Heizmann CW., Kroneck PM., Fritz G. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation ostendor-2007-3 Structural and functional insights into RAGE activation by multimeric S100B. in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Ostendorp T., Leclerc E., Galichet A., Koch M., Demling N., Weigle B., Heizmann CW., Kroneck PM., Fritz G. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation ostendor-2007-4 Structural and functional insights into RAGE activation by multimeric S100B. in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay predetermined predetermined participant predetermined Ostendorp T., Leclerc E., Galichet A., Koch M., Demling N., Weigle B., Heizmann CW., Kroneck PM., Fritz G. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation s100b_human Protein S100-B S100B S100 calcium-binding protein B S-100 protein subunit beta S-100 protein beta chain protein protein human Homo sapiens Human MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE rage_human Advanced glycosylation end product-specific receptor AGER RAGE Receptor for advanced glycosylation end products protein protein human Homo sapiens Human MAAGTAVGAWVLVLSLWGAVVGAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALALGILGGLGTAALLIGVILWQRRQRRGEERKAPENQEEEEERAELNQSEEPEAGESSTGGP s100b-6 680004 s100b_human S100B 680010 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction false false false f1c Protein has an dimeric form. mint s100b-6 680004 s100b_human S100B 680010 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 4.0 direct interaction direct interaction false false false f1c Protein has an tetrameric form. mint s100b-6 680004 s100b_human S100B 680010 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 6.0 direct interaction direct interaction false false false f1c Protein has an hexameric form. mint s100b-6 680004 s100b_human S100B 680010 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 8.0 direct interaction direct interaction false false false f1c Protein has an octameric form. mint s100b-6 680005 s100b_human S100B 680010 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction false false false Protein has an dimeric form. f1d mint s100b-6 680005 s100b_human S100B 680010 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 4.0 direct interaction direct interaction false false false Protein has an tetrameric form. f1d mint s100b-6 680005 s100b_human S100B 680010 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 6.0 direct interaction direct interaction false false false Protein has an hexameric form. f1d mint s100b-6 680005 s100b_human S100B 680010 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 8.0 direct interaction direct interaction false false false Protein has an octameric form. f1d mint ager-s100b-5 680006 s100b_human S100B 680010 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified rage_human sRAGE 680011 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false kd 1.1 micromolar f6a Tetrameric form of S100B links Rage with a Kd of 1.1 micromolar. homomint mint ager-s100b-6 680006 rage_human sRAGE 680011 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false s100b_human S100B 680010 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified direct interaction direct interaction false false false f6a kd 8.3 micromolar Dimeric form of S100B links Rage with a Kd of 8.3 micromolar. homomint mint s100b-6 680007 s100b_human S100B 680010 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false f3 Protein has an octameric form. mint ager-s100b-3 680008 s100b_human S100B 680010 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified rage_human sRAGE 680011 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified direct interaction direct interaction false false false SF4A S100B links RAGE as a dimer, tetramer and octamer. homomint mint ager-s100b-4 680009 s100b_human S100B 680010 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified rage_human sRAGE 680011 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified direct interaction direct interaction false false false SF4B S100B links RAGE as a dimer, tetramer and octamer. homomint mint