MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint lee-2007i-2 XRab40 and XCullin5 form a ubiquitin ligase complex essential for the noncanonical Wnt pathway. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Lee RH., Iioka H., Ohashi M., Iemura S., Natsume T., Kinoshita N. EMBO J. (0261-4189) 2007 Only protein-protein interactions imex curation lee-2007i-4 XRab40 and XCullin5 form a ubiquitin ligase complex essential for the noncanonical Wnt pathway. crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Lee RH., Iioka H., Ohashi M., Iemura S., Natsume T., Kinoshita N. EMBO J. (0261-4189) 2007 Only protein-protein interactions imex curation lee-2007i-1 XRab40 and XCullin5 form a ubiquitin ligase complex essential for the noncanonical Wnt pathway. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lee RH., Iioka H., Ohashi M., Iemura S., Natsume T., Kinoshita N. EMBO J. (0261-4189) 2007 Only protein-protein interactions imex curation lee-2007i-3 XRab40 and XCullin5 form a ubiquitin ligase complex essential for the noncanonical Wnt pathway. xenla-animal_cap Xenopus laevis animal cap animal_cap Animal cap Xenopus laevis animal cap cells are cells situated around the animal (pigmented) pole of a blastula or very early gastrula-stage embryo. This tissue is fated to become cement gland/neurectoderm on the dorsal side of the embryo and epidermis on the ventral side. Animal caps are composed of pluripotent cells that can be induced to form endodermal, mesodermal, or ectodermal cell types. XAO:0000036. fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Lee RH., Iioka H., Ohashi M., Iemura S., Natsume T., Kinoshita N. EMBO J. (0261-4189) 2007 Only protein-protein interactions imex curation q5xhf6_xenla rab40c.S rab40 rab40c XELAEV_18047665mg protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MGTQGSPVKSYDYLLKFLLVGDSDVGKGEILESLQDGASESPYSYSNGIDYKTTTILLDGRRVKLELWDTSGQGRFCTIFRSYSRGAQGILLVYDITNRWSFDGIDRWIKEIDEHAPGVPRILVGNRLHLAFKRQVPTEQARSYAEKNGMTFFEVSPLCNFNVTESFTELSRIVLMRHGMEKMWRPNKVFSLQDLCCRAIVSCTPVHLIDKLPLPVAIKSHLKSFSMANGMNAVMMHGRSYSVAGSSGGATGSGGGSKGNSLKRSKSIRPPQSPPQNCSRTNCKIS mint q6phw7_xenla Elongin-C eloc.L eloc tceb1 XELAEV_18031836mg XELAEV_18033803mg protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC mint q6phl7_xenla elob.L elob tceb2 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MDVFLMIRHHKTTIFTDAKENTTVYELKRIVEGILKRPPEDQKLYKDDQLLDDNKTLGDCGFTSQTARPQAPATVGLAFRSSGDSFEPLRVEPFSSPPELPDVMKPQETSGSANEQAVQ mint q7zx67_xenla Small monomeric GTPase rap2a.S rap2a XELAEV_18015658mg protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYEKVPVILVGNKVDLESEREVSSNEGRALAEDWGCPFMETSAKSKTMVDELFAEIVRQMNYAAQPDKDDPCCSACNIQ mint a7vk04_xenla cul5.L cul5 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MATSNLLKNKGSLQFEDKWDFMRPIVLKLLRQESVTKQQWFDLFSDVHAVCLWDDKGPAKIHQALKEDILDFIKQAQARVLSHQDDTALLKAYIVEWRKFFTQCDILPKPFCQLEITLMGKQGSNKKSNVEDSIVRKLMLDTWNESIFSNIKNRLQDSAMKLVHAERLGEAFDSQLVIGVRESYVNLCSNPEDKLQIYRDNFEKAYLDSTERFYRTQAPSYLQQNGVQNYMKYADAKLKEEENRALRYLETRRECNSVQALMECCVNALVTSFKETILAECQGMIKRNETEKLHLMFSLMDKVPNGIEPMLKDLEEHIVSAGLADMVAAAETITTDSEKYVEQLLTLFNRFSKLVKEAFQDDPRFLTARDKAYKAVVNDAAIFKLELPLKQKGVGLKTQPESKCPELLANYCDMLLRKTPLSKKLTSEEIEAKLKEVLLVLKYVQNKDVFMRYHKAHLTRRLILDISADSEIEENMVEWLREVGMPADYVNKLARMFQDIKVSEDLNQAFKEMHKNNKLALPADSANIKILNAGAWSRSSEKVFVSLPTELEDLIPEVEEFYKKNHSGRKLHWHHLMSNGIITFKNEVGQYDLEVTTFQLAVLFAWNQRPREKISFENLKLATELPDAELRRTLWSLVAFPKLKRQVLSYEPTVNSPKDFTEGTLFSVNQEFGLIKNGKVQKRGKINLIGRLQLTTERMREEENEGIVQLRILRTQEAIIQIMKMRKKITNAQLQTELVEILKNMFLPQKKMIKEQIEWLIEHKYIRRDECDINTFLYMA mint q6ddz8_xenla mink1.L mink mink1 XELAEV_18019343mg protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MASDPPARSLDDIDLSALRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKSPPGNDDQLWLVMEFCGAGSVTDLVKNTKGNALKEDCIAYICREILRGLSHLHAHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDIWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPKLKSKKWSKKFIDFIDTCLIKNYMSRPPTEPLLKHPFIRDQPTERQVRIQLKDHIDRSRKKRGEKDETEYEYSGSEDEEENHGDEGEPSSIMNVPGESTLRREFLRLQQENKSNSEALKQQQVGAQHRDSEAHIKQLLHERQRRIEEQKEERRRVEEQQRREREQRKQQEKEQQRRRDDIRREEERRMAEREQEYKRKQLEEQRQSERLQRQLQQEHAYLKSLQQQQQQQQQQKQQQEKKPLYHYNRGVMNPSEKPAWAREVEERSRLNKQSSPLAITKLSSVESAGNPSQTPPSQRPPEIQEHKPLRTTPQNRAAFRPTPRPNSLQDPLAPPVRHAPVPPPADRNHLSRQSSDPSPDGGPPSSRLERGPWVKLQPEVHPPKVPQRTTSIATALNTSGSGGSRPVQQGQPVRASNPDLRRAESGWERGDSLLQSPHPNLPQAGSLERNRIAPHKLEESSISPPGSKTPGEEHRSRPGRPADHLLVKDRPEDVPKAPKKALDYSSSSDELDSSDEEEEEGDAERQEPSRDSSGASRSGRDADTDSVSTMVVHDVEELMGSTSDSSYGDGTMVVQRTPEEERSLLHADSNGYTNLPDVVQPSHSPTEPKGQGTSPSKEGNGSDYQSRGLVKAPPKTSFTMFVDLGLYQSSGGGGDTIPVAASYVSGDPARLEQLKYEARKGSVVNVNPTNTRPHSDTPEIRKYKKRFNSEILCAALWGVNLLVGTENGLMLLDRSGQGKVYTLITRRRFQQMDVLEGLNLLITISGKRNKLRVYYLSWLRNKILHNDPEVEKKQGWSTVGDMDGCVHYKVVKYERIKFLVIALKNSVEVYAWAPKPYHKFMAFKSFTDIPHRPQLVDLTVEEGQRLKVIYGSCSGFHAVDVDSGNNYDIYIPVHIQSQINPHAIIFLPNTDGMEMLLCYEDEGVYVNTYGRIIKDVVLQWGEMPTSVAYICSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVYFMTLNRSCIMNW dvl1_human Segment polarity protein dishevelled homolog DVL-1 DVL1 DSH homolog 1 protein protein human Homo sapiens Human MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGVVKEEIFDDNAKLPCFNGRVVSWLVLAEGAHSDAGSQGTDSHTDLPPPLERTGGIGDSRPPSFHPNVASSRDGMDNETGTESMVSHRRERARRRNREEAARTNGHPRGDRRRDVGLPPDSASTALSSELESSSFVDSDEDGSTSRLSSSTEQSTSSRLIRKHKRRRRKQRLRQADRASSFSSITDSTMSLNIVTVTLNMERHHFLGISIVGQSNDRGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDVNFENMSNDDAVRVLREIVSQTGPISLTVAKCWDPTPRSYFTVPRADPVRPIDPAAWLSHTAALTGALPRYGTSPCSSAVTRTSSSSLTSSVPGAPQLEEAPLTVKSDMSAVVRVMQLPDSGLEIRDRMWLKITIANAVIGADVVDWLYTHVEGFKERREARKYASSLLKHGFLRHTVNKITFSEQCYYVFGDLCSNLATLNLNSGSSGTSDQDTLAPLPHPAAPWPLGQGYPYQYPGPPPCFPPAYQDPGFSYGSGSTGSQQSEGSKSSGSTRSSRRAPGREKERRAAGAGGSGSESDHTAPSGVGSSWRERPAGQLSRGSSPRSQASATAPGLPPPHPTTKAYTVVGGPPGGPPVRELAAVPPELTGSRQSFQKAMGNPCEFFVDIM ubiqp_xenla Polyubiquitin protein protein xenla Xenopus laevis (African clawed frog) African clawed frog QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG a4gat_human Lactosylceramide 4-alpha-galactosyltransferase A4GALT A14GALT A4GALT1 Alpha-1,4-galactosyltransferase UDP-galactose:beta-D-galactosyl-beta1-R 4-alpha-D-galactosyltransferase Alpha-1,4-N-acetylglucosaminyltransferase Alpha4Gal-T1 Globotriaosylceramide synthase CD77 synthase P1/Pk synthase protein protein human Homo sapiens Human MSKPPDLLLRLLRGAPRQRVCTLFIIGFKFTFFVSIMIYWHVVGEPKEKGQLYNLPAEIPCPTLTPPTPPSHGPTPGNIFFLETSDRTNPNFLFMCSVESAARTHPESHVLVLMKGLPGGNASLPRHLGISLLSCFPNVQMLPLDLRELFRDTPLADWYAAVQGRWEPYLLPVLSDASRIALMWKFGGIYLDTDFIVLKNLRNLTNVLGTQSRYVLNGAFLAFERRHEFMALCMRDFVDHYNGWIWGHQGPQLLTRVFKKWCSIRSLAESRACRGVTTLPPEAFYPIPWQDWKKYFEDINPEELPRLLSATYAVHVWNKKSQGTRFEATSRALLAQLHARYCPTTHEAMKMYL mint Necessary for the biosynthesis of the Pk antigen of blood histogroup P. Catalyzes the transfer of galactose to lactosylceramide and galactosylceramide. Necessary for the synthesis of the receptor for bacterial verotoxins goga2_human Golgin subfamily A member 2 GOLGA2 130 kDa cis-Golgi matrix protein GM130 autoantigen Golgin-95 protein protein human Homo sapiens Human MWPQPRLPPRPAMSEETRQSKLAAAKKKLREYQQRNSPGVPTGAKKKKKIKNGSNPETTTSGGCHSPEDTPKDNAATLQPSDDTVLPGGVPSPGASLTSMAASQNHDADNVPNLMDETKTFSSTESLRQLSQQLNGLVCESATCVNGEGPASSANLKDLESRYQQLAVALDSSYVTNKQLNITIEKLKQQNQEITDQLEEEKKECHQKQGALREQLQVHIQTIGILVSEKAELQTALAHTQHAARQKEGESEDLASRLQYSRRRVGELERALSAVSTQQKKADRYNKELTKERDALRLELYKNTQSNEDLKQEKSELEEKLRVLVTEKAGMQLNLEELQKKLEMTELLLQQFSSRCEAPDANQQLQQAMEERAQLEAHLGQVMESVRQLQMERDKYAENLKGESAMWRQRMQQMSEQVHTLREEKECSMSRVQELETSLAELRNQMAEPPPPEPPAGPSEVEQQLQAEAEHLRKELEGLAGQLQAQVQDNEGLSRLNREQEERLLELERAAELWGEQAEARRQILETMQNDRTTISRALSQNRELKEQLAELQSGFVKLTNENMEITSALQSEQHVKRELGKKLGELQEKLSELKETVELKSQEAQSLQQQRDQYLGHLQQYVAAYQQLTSEKEVLHNQLLLQTQLVDQLQQQEAQGKAVAEMARQELQETQERLEAATQQNQQLRAQLSLMAHPGEGDGLDREEEEDEEEEEEEAVAVPQPMPSIPEDLESREAMVAFFNSAVASAEEEQARLRGQLKEQRVRCRRLAHLLASAQKEPEAAAPAPGTGGDSVCGETHRALQGAMEKLQSRFMELMQEKADLKERVEELEHRCIQLSGETDTIGEYIALYQSQRAVLKERHREKEEYISRLAQDKEEMKVKLLELQELVLRLVGDRNEWHGRFLAAAQNPADEPTSGAPAPQELGAANQQGDLCEVSLAGSVEPAQGEAREGSPRDNPTAQQIMQLLREMQNPRERPGLGSNPCIPFFYRADENDEVKITVI rab40c-tceb1-1 673774 q5xhf6_xenla rab40 673778 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q6phw7_xenla elongin c 673779 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F2C domino mint rab40c-tceb2 673774 q6phl7_xenla elongin b 673780 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q5xhf6_xenla rab40 673778 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false F2C domino mint rab40c-rap2a-1 673774 q7zx67_xenla rap2 673781 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q5xhf6_xenla rab40 673778 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified undefined mutation mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F2C F2D mint rab40c-cul5-2 673774 q5xhf6_xenla rab40 673778 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false a7vk04_xenla elongin c cullin 5 673782 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F2C domino mint rap2a-mink1-5 673774 q7zx67_xenla rap2 673781 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified q6ddz8_xenla mink 673783 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f7a mint dvl1-mink1 673774 q6ddz8_xenla mink 673783 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false dvl1_human Dsh 673784 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified physical association physical association false false false f7a mint rap2a-ubiqp 673774 q7zx67_xenla rap2 673781 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ubiq_xenla Ubiquitin 673785 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false F6f mint a4galt-rab40c 673775 a4gat_human 1.4-galactosyltransferase 673786 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q5xhf6_xenla Rab40 673778 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false F4A mint rab40c-tceb1-2 673775 q6phw7_xenla elongin c 673779 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q5xhf6_xenla rab40 673778 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false F4c mint cul5-rab40c 673775 q5xhf6_xenla rab40 673778 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false a7vk04_xenla cullin 5 673782 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false F4D mint golga2-rab40c 673775 q5xhf6_xenla rab40 673778 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false goga2_human GM130 673787 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization false false false F4B mint rab40c-tceb1 673776 q5xhf6_xenla rab40 673778 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q6phw7_xenla elongin c 673779 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F2A mint rab40c-rap2a 673776 q7zx67_xenla Rap2 673781 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q5xhf6_xenla rab40 673778 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false F2A mint rab40c-rap2a-2 673777 q5xhf6_xenla rab40 673778 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q7zx67_xenla RAP2 673781 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false F6A F6B Same colocalization occurs in CHO cells. mint mink1-rap2a 673777 q7zx67_xenla RAP2 673781 immunostaining immunostaining unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q6ddz8_xenla rab40 mink 673783 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false F7B mint