MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint john-2007-3 The Caenorhabditis elegans septin complex is nonpolar. in vitro In vitro electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy predetermined predetermined participant predetermined John CM., Hite RK., Weirich CS., Fitzgerald DJ., Jawhari H., Faty M., Schläpfer D., Kroschewski R., Winkler FK., Walz T., Barral Y., Steinmetz MO. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation john-2007-1 The Caenorhabditis elegans septin complex is nonpolar. yeast Saccharomyces cerevisiae Baker's yeast fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined John CM., Hite RK., Weirich CS., Fitzgerald DJ., Jawhari H., Faty M., Schläpfer D., Kroschewski R., Winkler FK., Walz T., Barral Y., Steinmetz MO. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation john-2007-2 The Caenorhabditis elegans septin complex is nonpolar. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined John CM., Hite RK., Weirich CS., Fitzgerald DJ., Jawhari H., Faty M., Schläpfer D., Kroschewski R., Winkler FK., Walz T., Barral Y., Steinmetz MO. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation q25ar8_caeel Septin CELE_Y50E8A.4 unc-61 Y50E8A.4 protein protein caeel Caenorhabditis elegans MSDIEHKLQHLPPHQPPPPVPHHHQNQPTHNNTTTISSATSSINTTTTSKKPTIAAPTAPSPIKSLSDHTGRVMQLNGHVGFDSLPHQLVKKAVEAGFQFNLMCVGETGTGKTTLIESLFNMKLDFEPCNHELKTVELRTCTKDVAEGGIRVKLRLVETAGFGDQLDKDKSAKVIVDYLESQFETYLQEELKPRRMLQYFNDSRIHACLYFISPTGHGLKALDLVTLRELAKRVNVIPVIAKSDTTCKDELLRFKAKILSELKSQKIDIYTFPTDDETVSTTNKEMNKSVPFAVVGSIDFVKKENGQMVRARQYPWGIVEVENESHCDFVKLREALLRTNVDEMRQRTHESLYENYRRDRLRQMKIGDGETGPKIIEKLAQRRLQKHREHQDEFSRRELTLREEFQKKLDVTEGDMRKVEEGLAAREREVHENYNREASKLDMEIRQLTEERMKLMTKVSKKLRK mint q9u334_caeel Septin CELE_W09C5.2 unc-59 W09C5.2 protein protein caeel Caenorhabditis elegans MSSRTANSSSRNDESLRTGQHKENPNYWGFANFPNQVFRRAVKNGFDFTLMVVGRSGLGKSTFINTLFLAEINNLNEKESAPTHPHPSTVRVEEKLVKLVENSVSLNLTLVDTPGFGDAVNNSKCWEPIVNYVESKFFEQFCEETRIDRGEKIVDKCVHLCLYFIEPSGHGLKPIDIELMKHLHGRVNIVPVISKADCLTRDELLRFKKQIVKDAETAEIKLYKFPELEDPYTDKVAIEKLRKALPFAIIGSNMLKEKDGKKIRYREYPWGTVEVENMQHNDFLTLRDMIIRTNLIDMIDVTRNVHYENFRFRQMEGLPKNEKNRDPFTHLEEERRQKEQDLDEKRNTLEKVFTEKTSARKKRSDERMSALEELEQQNKQKIDAKRAEIIRLRHEISELKNGNLTSSQTSLAMYNENNHSQNSTLNSTTKSSPPPTSATSSSSGTMKKRMGGLGLFNRN mint unc_59-unc_61-2 667849 q25ar8_caeel unc-61 667852 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified q9u334_caeel unc-59 667853 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false F5A Proteins form heterotetramers. homomint mint unc_59-unc_61-3 667849 q9u334_caeel unc-59 667853 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false q25ar8_caeel unc-61 667852 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false F5B Proteins form heterotetramers. homomint mint unc_59-unc_61-4 667849 q9u334_caeel unc-59 667853 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q25ar8_caeel unc-61 667852 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false F5C Proteins form heterotetramers. homomint mint unc_59-unc_61 667850 q9u334_caeel unc-59 667853 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q25ar8_caeel unc-61 667852 immunostaining immunostaining unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell colocalization colocalization false false false F1B F1C organelles homomint mint unc_59-unc_61-1 667851 q25ar8_caeel unc-61 667852 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component purified purified q9u334_caeel unc-59 667853 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false F3 homomint mint