MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint timmins-2007-1 Crystal structure and mutational study of RecOR provide insight into its mode of DNA binding. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Timmins J., Leiros I., McSweeney S. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation recr_deira Recombination protein RecR recR DR_0198 protein protein strain atcc 13939 /-9 Deinococcus radiodurans MKYPPSLVSLIRELSRLPGIGPKSAQRLAFHLFEQPREDIERLASALLEAKRDLHVCPICFNITDAEKCDVCADPSRDQRTICVVEEPGDVIALERSGEYRGLYHVLHGVLSPMNGVGPDKLHIKPLLPRVGQGMEVILATGTTVEGDATALYLQRLLEPLGAAISRIAYGVPVGGSLEYTDEVTLGRALTGRQTVSKPQPPQRPGDEDGADGAAVPASR mint May play a role in DNA repair. It seems to be involved in an recBC-independent recombinational process of DNA repair. It may act with recF and recO q9rw50_deira DNA repair protein RecO recO Recombination protein O DR_0819 protein protein strain atcc 13939 /-9 Deinococcus radiodurans MRSRTANRSGIVIRRRVTPAGDIIVTLLTPQGKLKAIARGGVKGPLSSSLNLFHHVGVQVYQGPHNDLASVKQAVLEGALPTLAEPERYAFAHLMAEFADALFQEGEFSEQAFDLFAASLRGVAHQPDPEWVALVMSYKLLGLAGVIPQTARCARCGAPDPEHPDPLGGQLLCSKCAALPPYPPAVLDFLRHAVRRTVRASFEQPVPSADRPALWRALEKFVTVQVGGVHSWRQLVPSGVPVLS mint Involved in DNA repair and recF pathway recombination reco-recr 665227 recr_deira recR 665228 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified q9rw50_deira RecO 665229 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false F3 F2 F1 mint