MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint challa-2007-1 Drosophila Omi, a mitochondrial-localized IAP antagonist and proapoptotic serine protease. drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. imaging technique imaging technique microscopy predetermined predetermined participant predetermined Challa M., Malladi S., Pellock BJ., Dresnek D., Varadarajan S., Yin YW., White K., Bratton SB. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation challa-2007-2 Drosophila Omi, a mitochondrial-localized IAP antagonist and proapoptotic serine protease. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Challa M., Malladi S., Pellock BJ., Dresnek D., Varadarajan S., Yin YW., White K., Bratton SB. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation cyc1_drome Cytochrome c-1 Cyt-c-d CytC1 DC3 CG13263 Cytochrome c-distal protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MGSGDAENGKKIFVQKCAQCHTYEVGGKHKVGPNLGGVVGRKCGTAAGYKYTDANIKKGVTWTEGNLDEYLKDPKKYIPGTKMVFAGLKKAEERADLIAFLKSNK htra2_drome Serine protease HTRA2, mitochondrial CG8464 Omi/HtrA2 HtrA2 High temperature requirement protein A2 Omi stress-regulated endoprotease protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MALRGSHRLEVIFKRCIASPVLHSHAANRRSSQLAIKEGDPNSNGNSGQYQQNGEQKEKGWRRLVRFFVPFSLGAVVSAAIIQREDLTPTIAASKMTGRRRDFNFIADVVAGCADSVVYIEIKDTRHFDYFSGQPITASNGSGFIIEQNGLILTNAHVVINKPHTMVQVRLSDGRTFPATIEDVDQTSDLATLRIQVNNLSVMRLGKSSTLRSGEWVVALGSPLALSNTVTAGVISSTQRASQELGLRNRDINYLQTDAAITFGNSGGPLVNLDGEAIGVNSMKVTAGISFAIPIDYVKVFLERAAEKRKKGSAYKTGYPVKRYMGITMLTLTPDILFELKSRSQNMPSNLTHGVLVWKVIVGSPAHSGGLQPGDIVTHINKKEIKNSSDVYDALADNSKTLDIVILRGVKQMHVTITPEDP diap1_drome Death-associated inhibitor of apoptosis 1 Diap1 Apoptosis 1 inhibitor E3 ubiquitin-protein ligase th Iap1 Inhibitor of apoptosis 1 Protein thread th CG12284 RING-type E3 ubiquitin transferase Diap1 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MASVVADLPSYGPIAFDQVDNNTNATQLFKNNINKTRMNDLNREETRLKTFTDWPLDWLDKRQLAQTGMYFTHAGDKVKCFFCGVEIGCWEQEDQPVPEHQRWSPNCPLLRRRTTNNVPINAEALDRILPPISYDICGANDSTLEMREHAYAEGVIPMSQLIQSIGMNAVNAAGSVTGTAAPQPRVTVATHASTATQATGDVQPETCRPSAASGNYFPQYPEYAIETARLRTFEAWPRNLKQKPHQLAEAGFFYTGVGDRVRCFSCGGGLMDWNDNDEPWEQHALWLSQCRFVKLMKGQLYIDTVAAKPVLAEEKEESSSIGGVAVASTQASEEEQQTSLSSEEAVSGDVAPSVAPTAATRIFNKIVEATAVATPSTNSSGSTSIPEEKLCKICYGAEYNTAFLPCGHVVACAKCASSVTKCPLCRKPFTDVMRVYFS cyt_c_d-htra2 667153 cyc1_drome Cyt-c 667155 experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell htra2_drome dOmi 667156 experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false F2B organelles mint th-htra2 667154 htra2_drome dOmi 667156 polyclonal immunost polyclonal antibody immunostaining polyclonal immunost unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level iap1_drome DIAP1 667157 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F6B F3C mint