MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint cao-2007-1 POU-V factors antagonize maternal VegT activity and beta-Catenin signaling in Xenopus embryos. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Cao Y., Siegel D., Donow C., Knöchel S., Yuan L., Knöchel W. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation cao-2007-2 POU-V factors antagonize maternal VegT activity and beta-Catenin signaling in Xenopus embryos. xenla-embryo Xenopus laevis embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Cao Y., Siegel D., Donow C., Knöchel S., Yuan L., Knöchel W. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation p5f11_xenla POU domain, class 5, transcription factor 1.1 oct-25 pou5f1.1 POU class V protein oct-25 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MYSQQPFPAFAFNAGLMQDPANCHFGGYTGLGHPQPFSFAFSTLKSENGESGVQGMGDCTTPVMPWNSLASFDHQVQMENNQQGNPPRAPSPTLSDSRIKVKEEVVHETDSGEESPEPKYPSPPNPSLYYPNAWTGAPFWQVNPTPGNNINPMPNQTLVKNTSLPGNTTYPTPANQSPNTPVDCVTSSMESSRCSSTNSPNGAINERATTIPNGEMLDGGQSSDNEEEVPSESEMEQFAKDLKHKRVSLGYTQADVGYALGVLYGKMFSQTTICRFESLQLSFKNMCQLKPFLERWVVEAENNDNLQELINREQVIAQTRKRKRRTNIENIVKGTLESYFMKCPKPGAQEMVQIAKELNMDKDVVRVWFCNRRQKGKRQGMPTVEENDGEGYDVAQTMGSPPVGHYALQQVVTPQGYMAAPQIYASAFHKNDLFPQTVPHGMAMGGHIG mint vegta_xenla T-box protein VegT-A vegt-a Brachyury and Tbx-related protein T-box protein Antipodean apod brat vegt protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MRNCCRECGLSAGHLEPEASSNCASDVKSSPDMDSVSSQDSLYLPNTVGASLEDQDLWSQFHQEGTEMIITKSGRRMFPQCKIRLFGLHPYAKYMLLVDFVPLDNFRYKWNKNQWEAAGKAEPHPPCRTYVHPDSPAPGAHWMKDPICFQKLKLTNNTLDQQGHIILHSMHRYKPRFHVVQSDDMYNSPWGLVQVFSFPETEFTSVTAYQNEKITKLKINHNPFAKGFREQERSHKRDDVLKILQQSPSKRQKRKKWEDSPEADISDFPKAICVKEESIMDPAGVYQNWVSDHEANQGLTPHSPESEGANQEQQVPTSSSNFYNKSHYRRSSQHLSSPFELGEPSSRRLTPDIATVPDSDPDSLAVFHVIPTQNSAPERTCSMNFSMEAPMKQPLRGAMYSPYGADQWLVPAQGQYRPVGYTAYPTDLSTQGAVAHPHSAMSDWSQYSLFPYSCW mint Transcription factor involved in mesodermal patterning. Appears to pattern mesoderm along the dorsoventral and posterior axis. It activates WNT-8, EOMES and brachyury expression t7l1b_xenla Transcription factor 7-like 1-B tcf7l1-b HMG box transcription factor 3-B tcf3 tcf3b protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MPQLNSGGGDELGANDELIRFKDEGEQEEKSPGEGSAEGDLADVKSSLVNESENHSSDSDSEVERRPPPRETFEKPRDYLSEAFRRQQDAAFFKGPPYAGYPFLMIPDLGGHYLPNGALSPSARAYLQMKWPLLDSPSTAGLKDARSPSPAHLSNKVPVVQHPHHMHPLTPLITYSNEHFSPGTPPGHLSPEIDPKTGIPRPPHPSELSPYYPLSPGAVGQIPHPLGWLVPQQGQPMYSIPPGGFRHPYPALAMNASMSSLVSSRFSPHMVPPPHHSLHTSGIPHPAIVSPIVKQEPSSGNISPNLSTKSNVVVKKEEEKKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHSLSREEQAKYYELARKERQLHSQLYPSWSARDNYGKKKKRKREKQSPEMENYTKTKKMCVQHFPSDKSCDSPASSHGSMLDSPATPSAALASPAAPAATHSEQAQPLSLTTKPEARALSHSAAFLASKSPSSSSLSGHLPSPVGSPLLSRPIPLTSSILSPPGVFPSALQALPLLQAQPLSLVTRSSD mint Participates in the Wnt signaling pathway. Binds to DNA and acts as a repressor in the absence of ctnnb1-A and possibly ctnnb1-B, and as an activator in the presence of these proteins. Required early in development for the establishment of the dorsal body axis in response to maternal Wnt signaling a1y9b6_xenla Oct60 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MDQPILYSQTSFP fragmentation type: fragment mint p5f12_xenla POU domain, class 5, transcription factor 1.2 oct-91 POU class V protein oct-91 pou5f1.2 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MYNQQTYPSFTHNPALMPDGSGQYNLGTYTGMARHPHQAQAFFPFSGVKSDYGDLGGQTTSVGDTSAWNPLTSLDSANQLGISGQGNPFKNLKREREDDEEKSESPEPKCSPPSLPPAYYTHAWNPTTTFWSQVSSSGTTVVSKPLPTPLQPGDKCDPVEANKIFTSSPDKSGESGISSLDNSRCSSATSSSSGGTNVGTPRSLSRGASDGLSSDSEEEAPNSGEMEQFAKDLKHKRITMGYTQADVGYALGVLFGKTFSQTTICRFESLQLSFKNMCKLKPLLRSWLHEVENNENLQEIISRGQIIPQVQKRKHRTSIENNVKCTLENYFMQCSKPSAQEIAQIARELNMEKDVVRVWFCNRRQKGKRQVYPYIRENGGEPYDAPQTLTPPSQGPFPLPQVMPSQVFPTVPLGANPTIYVPTYHKNDMFPQAMHHGIGMGNQGN mint pou5f1_1-vegt_a 664443 p5f11_xenla oct-25 664445 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false vegta_xenla vegt 664446 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated physical association physical association false false false F3A mint pou5f1_1-tcf7l1_b 664443 t7l1b_xenla tcf3 664447 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated p5f11_xenla oct-25 664445 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F3A mint vegt_a-pou5f1_1 664443 p5f11_xenla oct-25 664445 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated vegta_xenla vegt 664446 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F3A mint tcf7l1_b-pou5f1_1 664443 t7l1b_xenla tcf3 664447 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false p5f11_xenla oct-25 664445 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated physical association physical association false false false F3A mint oct60-vegt_a 664443 vegta_xenla vegt 664446 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated a1y9b6_xenla oct-60 664448 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F3B mint pou5f1_2-tcf7l1_b 664443 t7l1b_xenla tcf3 664447 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated p5f12_xenla oct-91 664449 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F3B mint pou5f1_2-vegt_a 664443 vegta_xenla vegt 664446 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated p5f12_xenla oct-91 664449 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F3B mint oct60-tcf7l1_b 664443 t7l1b_xenla tcf3 664447 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated a1y9b6_xenla oct-60 664448 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F3B mint tcf7l1_b-vegt_a 664443 vegta_xenla vegt 664446 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated t7l1b_xenla tcf3 664447 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false F3C F3D mint vegt_a-tcf7l1_b 664443 vegta_xenla vegt 664446 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false t7l1b_xenla tcf3 664447 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated physical association physical association false false false F3C F3D mint tcf7l1_b-vegt_a-1 664443 t7l1b_xenla tcf3 664447 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false vegta_xenla vegt 664446 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated physical association physical association false false false F3C F3D mint tcf7l1_b-vegt_a-2 664444 t7l1b_xenla tcf3 664447 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false vegta_xenla vegt 664446 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F3E mint vegt_a-pou5f1_1-1 664444 p5f11_xenla oct-25 664445 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level vegta_xenla vegt 664446 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F3E mint tcf7l1_b-pou5f1_1-1 664444 p5f11_xenla oct-25 664445 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level t7l1b_xenla tcf3 664447 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F3E mint