MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint shrivastava-2007-1 Probing the nucleotide binding and phosphorylation by the histidine kinase of a novel three-protein two-component system from Mycobacterium tuberculosis. in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Shrivastava R., Ghosh AK., Das AK. FEBS Lett. (0014-5793) 2007 2009-01-08 Only protein-protein interactions imex curation hk1_myctu Sensor histidine kinase component HK1 Rv0600c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MPITPLLHESVARFAATGADITTRAEPDLFVSIDPDHLRRILTAVLDNAITHGDGEIAVTAHARDGAVDIGVRDHGPGFADHFLPVAFDRFTRADTARGGRGSGLGLAIVAALTTTHGGHANATNHPDGGAELRITLPTPRPPFHEELPRITSSDTKDPNREHDTSDQ mint hk2_myctu Sensor histidine kinase component HK2 Rv0601c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MALVLAAAGAVTVVQFRDAAHEADPDGALRGLTDDITADLVRELVTILPIVLVIAAVAAYLLSRAALRPVDRIRAAAQTLTTTPHPDTDAPLPVPPTDDEIAWLATTLNTMLTRLQRALAHEQQFVADASHELRTPLALLTTELELRCAGPDPPTS mint hk1-hk2 608307 o07778_myctu HK1 608308 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence enzyme enzyme neutral component neutral component purified purified o07777_myctu HK2 608309 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence enzyme target enzyme target substrate substrate neutral component neutral component purified purified phosphorylation phosphorylation reaction phosphorylation false false false F6 mint