IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ cai-2007-3 Coronin 1B coordinates Arp2/3 complex and cofilin activities at the leading edge. rat-rat-2 Rat R2 embryo cells rat-2 Rat embryo cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cai L., Marshall TW., Uetrecht AC., Schafer DA., Bear JE. jbear@email.unc.edu Cell (0092-8674) 2007 Only protein-protein interactions 7 imex curation cai-2007-1 Coronin 1B coordinates Arp2/3 complex and cofilin activities at the leading edge. in vitro In vitro phosphatase assay phosphatase assay predetermined predetermined participant predetermined Cai L., Marshall TW., Uetrecht AC., Schafer DA., Bear JE. jbear@email.unc.edu Cell (0092-8674) 2007 Only protein-protein interactions 7 imex curation cai-2007-2 Coronin 1B coordinates Arp2/3 complex and cofilin activities at the leading edge. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cai L., Marshall TW., Uetrecht AC., Schafer DA., Bear JE. jbear@email.unc.edu Cell (0092-8674) 2007 Only protein-protein interactions 7 imex curation cai-2007-4 Coronin 1B coordinates Arp2/3 complex and cofilin activities at the leading edge. rat-rat-2 Rat R2 embryo cells rat-2 Rat embryo cell line anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Cai L., Marshall TW., Uetrecht AC., Schafer DA., Bear JE. jbear@email.unc.edu Cell (0092-8674) 2007 Only protein-protein interactions 7 imex curation cai-2007-5 Coronin 1B coordinates Arp2/3 complex and cofilin activities at the leading edge. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Cai L., Marshall TW., Uetrecht AC., Schafer DA., Bear JE. jbear@email.unc.edu Cell (0092-8674) 2007 Only protein-protein interactions 7 imex curation cai-2007-6 Coronin 1B coordinates Arp2/3 complex and cofilin activities at the leading edge. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Cai L., Marshall TW., Uetrecht AC., Schafer DA., Bear JE. It is stated in the reference given by the authors (Biochemistry 1999 38 15212-15222) that Arp2/3 was purified from human leukocytes. jbear@email.unc.edu Cell (0092-8674) 2007 Only protein-protein interactions 7 imex curation cor1b_rat Coronin-1B Coro1b Coronin-2 protein protein rat Rattus norvegicus (Rat) Rat MSFRKVVRQSKFRHVFGQPVKNDQCYEDIRVSRVTWDSTFCAVNPKFLAVIVEASGGGAFMVLPLNKTGRIDKAYPTVCGHTGPVLDIDWCPHNDEVIASGSEDCTVMVWQIPENGLTSPLTEPVVVLEGHTKRVGIITWHPTARNVLLSAGCDNVVLIWNVGTAEELYRLDSLHPDLIYNVSWNHNGSLFCTACKDKSVRIIDPRRGTLVAEREKAHEGARPMRAIFLADGKVFTAGFSRMSERQLALWDPENFEEPMALQELDSSNGALLPFYDPDTSVVYVCGKGDSSIRYFEITDEPPYIHFLNTFTSKEPQRGMGSMPKRGLEVSKCEIARFYKLHERKCEPIVMTVPRKSDLFQDDLYPDTAGPDAALEAEDWVSGQDADPILISLREAYVPSKQRDLKVSRRNVLSDSKPAGYSRSGVSTATAITDIPSGNLAGSGEAGKLEEVMHGLRALRVLVKEQGERISRLEEHLGRMENGDT ssh1_human Protein phosphatase Slingshot homolog 1 SSH1 KIAA1298 SSH1L SSH-like protein 1 protein protein human Homo sapiens Human MALVTLQRSPTPSAASSSASNSELEAGSEEDRKLNLSLSESFFMVKGAALFLQQGSSPQGQRSLQHPHKHAGDLPQHLQVMINLLRCEDRIKLAVRLESAWADRVRYMVVVYSSGRQDTEENILLGVDFSSKESKSCTIGMVLRLWSDTKIHLDGDGGFSVSTAGRMHIFKPVSVQAMWSALQVLHKACEVARRHNYFPGGVALIWATYYESCISSEQSCINEWNAMQDLESTRPDSPALFVDKPTEGERTERLIKAKLRSIMMSQDLENVTSKEIRNELEKQMNCNLKELKEFIDNEMLLILGQMDKPSLIFDHLYLGSEWNASNLEELQGSGVDYILNVTREIDNFFPGLFAYHNIRVYDEETTDLLAHWNEAYHFINKAKRNHSKCLVHCKMGVSRSASTVIAYAMKEFGWPLEKAYNYVKQKRSITRPNAGFMRQLSEYEGILDASKQRHNKLWRQQTDSSLQQPVDDPAGPGDFLPETPDGTPESQLPFLDDAAQPGLGPPLPCCFRRLSDPLLPSPEDETGSLVHLEDPEREALLEEAAPPAEVHRPARQPQQGSGLCEKDVKKKLEFGSPKGRSGSLLQVEETEREEGLGAGRWGQLPTQLDQNLLNSENLNNNSKRSCPNGMEDDAIFGILNKVKPSYKSCADCMYPTASGAPEASRERCEDPNAPAICTQPAFLPHITSSPVAHLASRSRVPEKPASGPTEPPPFLPPAGSRRADTSGPGAGAALEPPASLLEPSRETPKVLPKSLLLKNSHCDKNPPSTEVVIKEESSPKKDMKPAKDLRLLFSNESEKPTTNSYLMQHQESIIQLQKAGLVRKHTKELERLKSVPADPAPPSRDGPASRLEASIPEESQDPAALHELGPLVMPSQAGSDEKSEAAPASLEGGSLKSPPPFFYRLDHTSSFSKDFLKTICYTPTSSSMSSNLTRSSSSDSIHSVRGKPGLVKQRTQEIETRLRLAGLTVSSPLKRSHSLAKLGSLTFSTEDLSSEADPSTVADSQDTTLSESSFLHEPQGTPRDPAATSKPSGKPAPENLKSPSWMSKS arpc2_rat Actin-related protein 2/3 complex subunit 2 Arpc2 Arp2/3 complex 34 kDa subunit protein protein rat Rattus norvegicus (Rat) Rat MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNATARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITRKTFSST cor1b_human Coronin-1B CORO1B Coronin-2 protein protein human Homo sapiens Human MSFRKVVRQSKFRHVFGQPVKNDQCYEDIRVSRVTWDSTFCAVNPKFLAVIVEASGGGAFLVLPLSKTGRIDKAYPTVCGHTGPVLDIDWCPHNDEVIASGSEDCTVMVWQIPENGLTSPLTEPVVVLEGHTKRVGIIAWHPTARNVLLSAGCDNVVLIWNVGTAEELYRLDSLHPDLIYNVSWNHNGSLFCSACKDKSVRIIDPRRGTLVAEREKAHEGARPMRAIFLADGKVFTTGFSRMSERQLALWDPENLEEPMALQELDSSNGALLPFYDPDTSVVYVCGKGDSSIRYFEITEEPPYIHFLNTFTSKEPQRGMGSMPKRGLEVSKCEIARFYKLHERKCEPIVMTVPRKSDLFQDDLYPDTAGPEAALEAEEWVSGRDADPILISLREAYVPSKQRDLKISRRNVLSDSRPAMAPGSSHLGAPASTTTAADATPSGSLARAGEAGKLEEVMQELRALRALVKEQGDRICRLEEQLGRMENGDA arpc2_human Actin-related protein 2/3 complex subunit 2 ARPC2 ARC34 PRO2446 Arp2/3 complex 34 kDa subunit protein protein human Homo sapiens Human MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR coro1b-arpc2-1 p34Arc and SSH1L-GFP coimmunoprecipitated with Coronin 1B in Rat2 lysates 599374 N/A 599380 unspecified role unspecified role bait bait N/A 599381 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 599382 unspecified role unspecified role prey prey association association false false false 4 I arpc2-coro1b Coronin 1B and SSH1L-GFP coimmunoprecipitated with p34Arcin Rat2 lysates 599374 N/A 599381 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 599382 unspecified role unspecified role bait bait N/A 599380 unspecified role unspecified role prey prey association association false false false 4 J These interactions do not occur in Coronin 1B-depleted cells. The evidence suggests SSH1L, Coronin 1B and Arp2/3 (as reported by p34Arc) exist in a ternary complex, bridged by Coronin 1B. ssh1-coro1b Recombinant Coronin 1 B was dephosphorylated by SSH1L-myc in vitro 599375 N/A 599383 enzyme target enzyme target substrate substrate unspecified role unspecified role region opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 599381 enzyme enzyme unspecified role unspecified role region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. dephosphorylation dephosphorylation reaction dephosphorylation false false false Recombinant Coronin 1 B was expressed in Drosophila S2 cells or HEK-293 cells. 4 C Coronin 1 B was dephosphorylated by Slingshot (SSH1L). coro1b-arpc2 SSH1L-myc and p34Arc coimmunoprecipitate with Coronin 1 B in HEK293 lysates 599376 N/A 599384 unspecified role unspecified role prey prey N/A 599383 unspecified role unspecified role bait bait N/A 599381 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 4 H ssh1-arpc2-1 SSH1L-GFP coimmunoprecipitated Coronin 1B and p34Arc from Rat2 lysate 599377 N/A 599382 unspecified role unspecified role prey prey N/A 599380 unspecified role unspecified role prey prey N/A 599381 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 4 I These interactions did not occur after Coronin 1B was immunodepleted from the cell lysate. The evidence suggests Coronin 1B, SSH1L, and Arp2/3 (as reported by the p34 subunit) exist in a ternary complex, bridged by Coronin 1B. ssh1-arpc2 Coronin 1 B and p34Arc coimmunoprecipitate with SSH1L-myc in HEK293 lysates 599378 N/A 599381 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 599384 unspecified role unspecified role prey prey N/A 599383 unspecified role unspecified role prey prey association association false false false 4 H coro1b-arpc2-2 His-Coronin 1 B pulls down Arp2/3 (as reported by p34Arc) in vitro 599379 N/A 599383 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 599384 unspecified role unspecified role prey prey human-leukocyte Homo sapiens leukocyte Leukocyte (white blood cell) physical association physical association false false false 3 C The Arp2/3 complex is reported by p34Arc. Recombinant Coronin 1 B is expressed in Drosphila S2 cells or HEK293 cells.