MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint maple-2007-1 ARC3 is a stromal Z-ring accessory protein essential for plastid division. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Maple J., Vojta L., Soll J., Møller SG. EMBO Rep. (1469-221X) 2007 2009-01-08 Only protein-protein interactions imex curation maple-2007-2 ARC3 is a stromal Z-ring accessory protein essential for plastid division. tobac-leaf Nicotiana tabacum (tobacco) leaf leaf leaf bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Maple J., Vojta L., Soll J., Møller SG. EMBO Rep. (1469-221X) 2007 2009-01-08 Only protein-protein interactions imex curation mine1_arath Cell division topological specificity factor homolog, chloroplastic MINE1 ARC12 F10D13.22 At1g69390 Protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 12 F23O10.25 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAMSSGTLRISATLVSPYHHHHRNRLSLPSSSSKVDFTGFISNGVNSLETQKCTPGLAISRENTRGQVKVLARNTGDYELSPSPAEQEIESFLYNAINMGFFDRLNLAWKIIFPSHASRRSSNARIAKQRLKMILFSDRCDVSDEAKRKIVNNIIHALSDFVEIESEEKVQLNVSTDGDLGTIYSVTVPVRRVKPEYQDVDEAGTITNVEYKDTRDGSVDVRFDFYVPE arc3_arath Protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 3 At1g75010 ARC3 F9E10.14 F25A4.3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MPISMELPVFSTLRVPLFSRLALLPTFGVPFSSLGATTRLNCTSRKARRICVMCLVRDSAPIETCERAGEDGSDEFIEVLVIGSRKESIMDSCLDSPFPSLPLRFWSISKDSSGGLVLQQRLNHQDNALKTMNPIELLQSRPRAFILVASAGYGSDQVEAINILSAVRSGGNLAVAVLLKPFSFEGRKRLEEVNELARKLQQHTNFCIDIDIEVLLQKDLVTLDEALRNANNAVSMAINAASALISGMHGNFIDVMHKDLKELEGSEVKTILESYKEAKVGFGVGHNLKTSILRAIYDCPFFRPGLKDLNAIICIVASSVPLQKKDVKTILRTFRQTMEYTGDIIVSTVHEPDLEPKVRVTTFFILSSSEVETSNKGNIFSGLVPFVLNIFTRYRSQLQKETNIGLGETPVSIKDSADSTDVKTSNQNIEEFEIDSEDLLEVSENGDDSEYPLKEGEPSRNSRLDLKDENVEDFGAIQREPIANWSMDQGYQIEQKWQADSGDTAVLSLGIVNLPVGVRPSKKLNSNLSVASQLSRKADSREESFFNPNGSTKDSSDTASTLLSEKYADFTKQRNLSARASSMLEAERDSSKRWSPILEMQYRGGLFKGRCQGGLPEGKGRLVLGDGSIYDGMWHNGKRSGLGTFYFKNGDVFQGTWREDLIHGKGWFYFHKGDRWFANFWKGKASGEGRFYSKSGEIFFGHFKDGWRHGQFLCIDLDGTRYSETWDDGVLIDRKQVDAGD ftsz1_arath Cell division protein FtsZ homolog 1, chloroplastic FTSZ1 MCO15.23 At5g55280 ARC10 FTSZ1-1 PMI4 Protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 10 Protein PLASTID MOVEMENT IMPAIRED4 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAIIPLAQLNELTISSSSSSFLTKSISSHSLHSSCICASSRISQFRGGFSKRRSDSTRSKSMRLRCSFSPMESARIKVIGVGGGGNNAVNRMISSGLQSVDFYAINTDSQALLQSSAENPLQIGELLTRGLGTGGNPLLGEQAAEESKDAIANALKGSDLVFITAGMGGGTGSGAAPVVAQISKDAGYLTVGVVTYPFSFEGRKRSLQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGKDITLQEVNRVSQVVTSLADPSANIIFGAVVDDRYTGEIHVTIIATGFSQSFQKTLLTDPRAAKLLDKMGSSGQQENKGMSLPHQKQSPSTISTKSSSPRRLFF mind1_arath Putative septum site-determining protein minD homolog, chloroplastic MIND1 At5g24020 ARC11 Protein ACCUMULATION AND REPLICATION OF CHLOROPLASTS 11 Septum site-determining protein MinD1 MZF18.10 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASLRLFSTNHQSLLLPSSLSQKTLISSPRFVNNPSRRSPIRSVLQFNRKPELAGETPRIVVITSGKGGVGKTTTTANVGLSLARYGFSVVAIDADLGLRNLDLLLGLENRVNYTCVEVINGDCRLDQALVRDKRWSNFELLCISKPRSKLPMGFGGKALEWLVDALKTRPEGSPDFIIIDCPAGIDAGFITAITPANEAVLVTTPDITALRDADRVTGLLECDGIRDIKMIVNRVRTDMIKGEDMMSVLDVQEMLGLSLLGVIPEDSEVIRSTNRGFPLVLNKPPTLAGLAFEQAAWRLVEQDSMKAVMVEEEPKKRGFFSFFGG arc3-mine1 598002 q9c4z7_arath AtMinE1 598004 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q6f6b5_arath ARC3 598005 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F2A SF1 mint arc3-arc3 598002 q6f6b5_arath ARC3 598005 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q6f6b5_arath ARC3 598005 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F2A SF1 mint arc3-ftsz1 598002 ftsz_arath FTSZ1-1 598006 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q6f6b5_arath ARC3 598005 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F2A SF1 mint arc3-mind1 598002 q6f6b5_arath ARC3 598005 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q9mba2_arath AtminD1 598007 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F2A mint arc3-mine1-1 598003 q9c4z7_arath MInE1 598004 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell yfp tagged yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q6f6b5_arath ARC3 598005 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell yfp tagged yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false T1 F2B mint arc3-ftsz1-1 598003 q6f6b5_arath ARC3 598005 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yfp tagged yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ftsz_arath FTSZ1-1 598006 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell yfp tagged yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false T1 F2B mint arc3-mind1-1 598003 q9mba2_arath AtMIND1 598007 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell yfp tagged yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q6f6b5_arath ARC3 598005 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell yfp tagged yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false T1 F2B mint arc3-mine1-2 598003 q9c4z7_arath AtMINE1 598004 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell yfp tagged yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q6f6b5_arath ARC3 598005 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell yfp tagged yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false T1 F2B mint