MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint jung-2007-1 Subcellular localization of Daxx determines its opposing functions in ischemic cell death. rat-h9c2 h9c2 rat myoblasts h9c2 h9c2 rat myoblasts imaging technique imaging technique microscopy predetermined predetermined participant predetermined Jung YS., Kim HY., Lee YJ., Kim E. FEBS Lett. (0014-5793) 2007 2009-01-08 Only protein-protein interactions imex curation p53_rat Cellular tumor antigen p53 Tp53 P53 Tumor suppressor p53 protein protein rat Rattus norvegicus (Rat) Rat MEDSQSDMSIELPLSQETFSCLWKLLPPDDILPTTATGSPNSMEDLFLPQDVAELLEGPEEALQVSAPAAQEPGTEAPAPVAPASATPWPLSSSVPSQKTYQGNYGFHLGFLQSGTAKSVMCTYSISLNKLFCQLAKTCPVQLWVTSTPPPGTRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNPYAEYLDDRQTFRHSVVVPYEPPEVGSDYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKKEEHCPELPPGSAKRALPTSTSSSPQQKKKPLDGEYFTLKIRGRERFEMFRELNEALELKDARAAEESGDSRAHSSYPKTKKGQSTSRHKKPMIKKVGPDSD daxx_rat Death domain-associated protein 6 Daxx Daxx protein protein rat Rattus norvegicus (Rat) Rat MATDDSIIVLDDDDEDEAAAQPGPSNPASNPVSPGPEASGPSESHGDGGSSNSGSRKCYKLENEKLFEEFLELCKMQTSDHPEVVPFLHKLQQRAQSAFLASAEFRNILSRVLSRSRNRPAKLYVYINELCTVLKAHSIKKKLNLAPAASAESSGDNPPTDPPSDLTNTETTASEASRTRGSRRQIQRLEQLLALYVAEIQRLQEKELDLSELDDPDSSYLQEARLKRKLIRLFGRLCDLKDCSSLTGKVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAATRHSLGLPRQQLQLLAQDAFRDVGVRLQERRHLDLIYNFGCHLTDDYRPGVDPALTDPTLARRLRENRTLAMSRLDEVISKYAMMQDKSEEGERQKRRARLLATSQSSDLPKASSDSGEGPSGVASQEDPTTPKAETEDEEDDEESDDEEEEEEEEEEEATEDEDEDLEQLQEDQDDEEEEEGDNEDDKSPASPSPIFRRKEFSNPQKGSGPQEEQQERGLTGTPASPLEASPGLPSTDAESSGEQLQERLLAGESPVSQLSELDMEALPEETIPSPEERGISSSRRKSDSSLPTILENGAAMVTSTSFNGRVSSHPCRDASPPSKRFRKEKKQLGPGPLGNSYVKKQTMAQQDSGWKISVLSTPSSPLASVGPVADSSTRVDSPSHELVTSSLCNPSPSLILQTPQSQSPRPCIYKTSVATQCDPEEIIVLSDSD Proposed to mediate activation of the JNK pathway and apoptosis via MAP3K5 in response to signaling from TNFRSF6 and TGFBR2. Interaction with HSPB1/HSP27 may prevent interaction with TNFRSF6 and MAP3K5 and block DAXX-mediated apoptosis. In contrast, in lymphoid cells JNC activation and TNFRSF6-mediated apoptosis may not involve DAXX. Seems to regulate transcription in PML/POD/ND10 nuclear bodies together with PML and may influence TNFRSF6-dependent apoptosis thereby. Down-regulates basal and activated transcription. Seems to act as a transcriptional co-repressor and inhibits PAX3 and ETS1 through direct protein-protein interaction. Modulates PAX5 activity. Its transcription repressor activity is modulated by recruiting it to subnuclear compartments like the nucleolus or PML/POD/ND10 nuclear bodies through interactions with MCSR1 and PML, respectively mint homomint sumo1_rat Small ubiquitin-related modifier 1 Sumo1 protein protein rat Rattus norvegicus (Rat) Rat MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV mint Ubiquitin-like protein which can be covalently attached to target lysines as a monomer. Does not seem to be involved in protein degradation and may function as an antagonist of ubiquitin in the degradation process. Plays a role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Involved in targeting RANGAP1 to the nuclear pore complex protein RANBP2. Covalent attachment to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by an E3 ligase such as PIAS1-4, RANBP2 or CBX4 daxx-tp53-6 607469 p53_rat P53 607470 experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell daxx_rat Daxx 607471 experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization false false false F2B homomint mint daxx-sumo1 607469 daxx_rat Daxx 607471 experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell sumo1_rat Sumo1 607472 experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization false false false F2C homomint mint