MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint moza-2007-1 Structural basis of T-cell specificity and activation by the bacterial superantigen TSST-1. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Moza B., Varma AK., Buonpane RA., Zhu P., Herfst CA., Nicholson MJ., Wilbuer AK., Seth NP., Wucherpfennig KW., McCormick JK., Kranz DM., Sundberg EJ. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation moza-2007-2 Structural basis of T-cell specificity and activation by the bacterial superantigen TSST-1. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Moza B., Varma AK., Buonpane RA., Zhu P., Herfst CA., Nicholson MJ., Wilbuer AK., Seth NP., Wucherpfennig KW., McCormick JK., Kranz DM., Sundberg EJ. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation q8wlq7_human HLA-DR4 protein protein human Homo sapiens Human LEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPSAEYWNSQKDLLEQRRAEVDTYCRHNYGVV fragmentation type: fragment mint tsst_staau Toxic shock syndrome toxin-1 tst protein protein staau Staphylococcus aureus MNKKLLMNFFIVSPLLLATTATDFTPVPLSSNQIIKTAKASTNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYGPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN mint Responsible for the symptoms of toxic shock syndrome tvbl3_human T cell receptor beta variable 12-3 T-cell receptor beta chain V region YT35 TCRBV12S3 TRBV12-3 TCRBV8S1 protein protein human Homo sapiens Human MDSWTFCCVSLCILVAKHTDAGVIQSPRHEVTEMGQEVTLRCKPISGHNSLFWYRQTMMRGLELLIYFNNNVPIDDSGMPEDRFSAKMPNASFSTLKIQPSEPRDSAVYFCASSL hla_dr4-tst 595788 q8wlq7_human 595790 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role neutral component neutral component purified purified tsst_staau TSST1 595791 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false F4A kd 1 micromolar mint trbv12_3-tst 595789 tsst_staau TSST1 595791 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role neutral component neutral component purified purified tvb1_human 595792 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false F2 F1 mint