UniProt UniProt http://www.uniprot.org imai-2007-1 Peculiar protein-protein interactions of the novel endoplasmic reticulum membrane protein Rcr1 and ubiquitin ligase Rsp5. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Imai K., Noda Y., Adachi H., Yoda K. asdfg@mail.ecc.u-tokyo.ac.jp Biosci. Biotechnol. Biochem. (0916-8451) 2007 Only protein-protein interactions imex curation imai-2007-2 Peculiar protein-protein interactions of the novel endoplasmic reticulum membrane protein Rcr1 and ubiquitin ligase Rsp5. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Imai K., Noda Y., Adachi H., Yoda K. asdfg@mail.ecc.u-tokyo.ac.jp Biosci. Biotechnol. Biochem. (0916-8451) 2007 Only protein-protein interactions imex curation imai-2007-3 Peculiar protein-protein interactions of the novel endoplasmic reticulum membrane protein Rcr1 and ubiquitin ligase Rsp5. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Imai K., Noda Y., Adachi H., Yoda K. asdfg@mail.ecc.u-tokyo.ac.jp Biosci. Biotechnol. Biochem. (0916-8451) 2007 Only protein-protein interactions imex curation rsp5_yeast E3 ubiquitin-protein ligase RSP5 RSP5 MDP1 NPI1 YER125W SYGP-ORF41 Reverses SPT-phenotype protein 5 HECT-type E3 ubiquitin transferase RSP5 protein protein yeast Saccharomyces cerevisiae Baker's yeast MPSSISVKLVAAESLYKRDVFRSPDPFAVLTIDGYQTKSTSAAKKTLNPYWNETFKFDDINENSILTIQVFDQKKFKKKDQGFLGVVNVRVGDVLGHLDEDTATSSGRPREETITRDLKKSNDGMAVSGRLIVVLSKLPSSSPHSQAPSGHTASSSTNTSSTTRTNGHSTSSTRNHSTSHPSRGTAQAVESTLQSGTTAATNTATTSHRSTNSTSSATRQYSSFEDQYGRLPPGWERRTDNFGRTYYVDHNTRTTTWKRPTLDQTEAERGNQLNANTELERRQHRGRTLPGGSSDNSSVTVQVGGGSNIPPVNGAAAAAFAATGGTTSGLGELPSGWEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQQQPVSQLGPLPSGWEMRLTNTARVYFVDHNTKTTTWDDPRLPSSLDQNVPQYKRDFRRKVIYFRSQPALRILPGQCHIKVRRKNIFEDAYQEIMRQTPEDLKKRLMIKFDGEEGLDYGGVSREFFFLLSHEMFNPFYCLFEYSAYDNYTIQINPNSGINPEHLNYFKFIGRVVGLGVFHRRFLDAFFVGALYKMMLRKKVVLQDMEGVDAEVYNSLNWMLENSIDGVLDLTFSADDERFGEVVTVDLKPDGRNIEVTDGNKKEYVELYTQWRIVDRVQEQFKAFMDGFNELIPEDLVTVFDERELELLIGGIAEIDIEDWKKHTDYRGYQESDEVIQWFWKCVSEWDNEQRARLLQFTTGTSRIPVNGFKDLQGSDGPRRFTIEKAGEVQQLPKSHTCFNRVDLPQYVDYDSMKQKLTLAVEETIGFGQE 6F1836384479E70F rcr1_yeast Protein RCR1 YBR005W YBR0111 RCR1 Resistance to Congo red protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MGLISYENEAINEVKKADNHHVSKFVTSYYGPSSSSWQSGIWILFVLFVAAVILIILFTFVANRRRRRMGRAPIRGTAWLTPPSYRQSQQQYTGTVQQRTDDYVPEYTETANEHDLGYYDQRGEFHPNDKAAYVAPPPLVQECSSESVNSLERPPAAVVHQANSLDTDYGLTRPSNGRVPAVSDTVEQLERLPGGTTTQEINPPERAKVNARS yno4_yeast Uncharacterized protein YNL144C N1205 N1790 YNL144C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSSIFEMTIDHDGMDSTGLKLSQTASSISMGDEFLCSSTTSNSILDSPLPKVTFNHIDSITDINTNIMNEIVEPQSGVDVDVADKNVLYCIDPYPVEPPCYDFANPSKVIRYPIYEHCRPCLTSVKPPSYTPSVEHYTVVSMKMEKLSPFENASSRLWNNFILQINSTQINFYSIDDSLTRHIKNYRGGDMFDHSHHSKTASDRHHSARSLLNAFTTKSTYQFDKYDKERICGEIARDEHKFLSDERLFKSYSLQCAKVGLPIDYSSRDFVLRMRCEGQQFLVQFSHVDELIYWAMYLNMGISLSLDLELREMPTYRSVPRRRHPRARRFKQHNKNKNKNKSRQNSDRNDSRSHSLLLRRSHTSSVVTKVATGNERPTNKSRSRSLSLLPPSVSDASHDSNGPNDSGSLAGESSQTDFCGLFTSKLRNFFKTDSSSRKNSNMDIGQKMRSKELNSVQEEIDDNGSTTNTNTSVLSSTFSPTAHSVLTAQTSIHENFRSRSNSNPIDPLRCDRSVLKINNFEPVYEGTGRSTISNSAERTNREEKLNRGNEDVNGDEDDDEDEDDANYEEDDEDGYVEDDDINRLVYLDERESRYENADVEYGTIFSTKSFSVTGCLNHDFPKKLSLKCGNKNQSSNDSKWAPATQLVSRKRYIKDSLRCIKPLTEDHPWVGKIIFKPALPPAFETNNPPIRVYSGEDSTDLMHVKNHYLKPYIVGSCGFLKTGSKLFHFYDRTNDLTNL rcr1-rsp5-1 657812 N/A 657815 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 657816 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1A rcr1-ynl144c-1 657812 N/A 657816 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 657817 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 657827 657825 physical association physical association false false false 1A rcr1-rsp5-2 657813 N/A 657815 unspecified role unspecified role prey prey ww region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 657816 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P38212:p.Pro82_Pro83delinsGlnAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P38212:p.Pro105Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1B rcr1-ynl144c-2 657813 N/A 657816 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P38212:p.Pro82_Pro83delinsGlnAla mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false N/A 657817 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 657840 657837 physical association physical association false false false 1C rcr1-rsp5-3 657814 N/A 657815 unspecified role unspecified role prey prey N/A 657816 unspecified role unspecified role bait bait P38212:p.Pro82_Pro83delinsGlnAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P38212:p.Pro105Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P38212:p.[Pro82_Pro83delinsGlnAla;Pro105Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1D