MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint kleijnen-2007-1 The ubiquitin-proteasome system regulates membrane fusion of yeast vacuoles. yeast Saccharomyces cerevisiae Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Kleijnen MF., Kirkpatrick DS., Gygi SP. Virus - Publications including interactions involving viral proteins maurits_kleijnen@hms.harvard.edu EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation kleijnen-2007-2 The ubiquitin-proteasome system regulates membrane fusion of yeast vacuoles. yeast Saccharomyces cerevisiae Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Kleijnen MF., Kirkpatrick DS., Gygi SP. Virus - Publications including interactions involving viral proteins maurits_kleijnen@hms.harvard.edu EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation ubi4p_yeast Polyubiquitin UBI4 SCD2 YLL039C protein protein yeast Saccharomyces cerevisiae Baker's yeast MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGN Protein modifier which can be covalently attached to target lysines either as a monomer or as a lysine-linked polymer. Attachment to proteins as a Lys-48-linked polymer usually leads to their degradation by proteasome. Attachment to proteins as a monomer or as an alternatively linked polymer does not lead to proteasomal degradation and may be required for numerous functions, including maintenance of chromatin structure, regulation of gene expression, stress response, ribosome biogenesis and DNA repair mint gyp7_yeast GTPase-activating protein GYP7 YDL234C GYP7 GAP for YPT7 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSKILFCKSKVFLHPTSDARDNIAGFLLLTLEANKLSHQAILQYIPESGLSTLEISKLLKHEAKVGTCPTSTPFVIENSINFSNLVNTSLGQAFEISLSQIYCIQFRPPSPNGWYVGSLVIYPLTEQFTGFQPPVLFFHDQLCPSTTDKLKRLRKSMNPFDDSDELYWGGVDLRNKINELMELKKSNLEPEFWLVNPSLNDLRNFVSKDLLESYNNSKKDTTELATAGVKLNEKFQEWKWNVMSKIADVTTKSTNFIDSWLTNNSPIQKSQIDNEYLQKLLNNEKVKQIEQDYDSARVYLANWSLGVKQEAERYQKQNKLFDSYRNNIFNDLNLTDELSDTEINNALQRQFPLTEAKWNSLWDENDGRLRVTVNEVKDFIFHGGLENDSLRGKVWGFLLEIYPWDSSQDERVQIDQTLAAEYDQLKLTWSKDFLQFDDEDEEEYWNDQLFRISKDVRRCDRNLEIFQYNTIDGLPPPPQQLPANENNSTSPESANDESDDADDGVRNPHLIHLQNILITYNVYNTNLGYVQGMTDLLSPIYVIMKEEWKTFWCFTHFMDIMERNFLRDQSGIHEQMLTLVELVQLMLPELSEHLNKCDSGNLFFCFRMLLVWFKREFEMEDIMHIWENFWTFYYSSQFQLFFMLAILQKNSQAILQHLNQFDQILKFFNELNGKLDWNDLMVRAELLFKKFEKMMHVMERDLQNVSSSSSSSSTGVLPCQSERLTLLLSKKPIIRHEGQRSKNSVK 10F0F2B11A9993A6 rho1_yeast GTP-binding protein RHO1 RHO1 YPR165W P9325.3 Rho-type GTPase 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSQQVGNSIRRKLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVADVEVDGRRVELALWDTAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQEKWIAEVLHFCQGVPIILVGCKVDLRNDPQTIEQLRQEGQQPVTSQEGQSVADQIGATGYYECSAKTGYGVREVFEAATRASLMGKSKTNGKAKKNTTEKKKKKCVLL 630B17E9E34CFE75 gyp7-ubi4 593119 ubi4p_yeast 593121 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false gyp7_yeast 593122 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F3A homomint mint rho1-ubi4 593119 ubi4p_yeast 593121 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rho1_yeast 593123 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F3A homomint mint gyp7-ubi4-1 593120 ubi4p_yeast 593121 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false gyp7_yeast 593122 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false F3D homomint mint