MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint bernis-2007-2 Pin1 stabilizes Emi1 during G2 phase by preventing its association with SCF(betatrcp). in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Bernis C., Vigneron S., Burgess A., Labbé JC., Fesquet D., Castro A., Lorca T. EMBO Rep. (1469-221X) 2007 2009-01-08 Only protein-protein interactions imex curation bernis-2007-1 Pin1 stabilizes Emi1 during G2 phase by preventing its association with SCF(betatrcp). in vitro In vitro pull down pull down predetermined predetermined participant predetermined Bernis C., Vigneron S., Burgess A., Labbé JC., Fesquet D., Castro A., Lorca T. EMBO Rep. (1469-221X) 2007 2009-01-08 Only protein-protein interactions imex curation bernis-2007-3 Pin1 stabilizes Emi1 during G2 phase by preventing its association with SCF(betatrcp). xenla-xl2 Xenopus laevis tadpole cell line XL2 xl2 Xenopus laevis tadpole cell line XL2 anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Bernis C., Vigneron S., Burgess A., Labbé JC., Fesquet D., Castro A., Lorca T. EMBO Rep. (1469-221X) 2007 2009-01-08 Only protein-protein interactions imex curation fbx5a_xenla F-box only protein 5-A fbxo5-a Early mitotic inhibitor 1-A emi1-a protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MMCGFASNQSPKKLSSKKSSATNVHLEISPVKHHPPCKVYENVQGSCLDSAICTTVAKCADLTDDLPVHNKENLLHRLNDLETNSYEEYSALQDSGYSSILQNDSPCQDETDRKVSDIQVRETPKNFMSYQRPFHTLSKINLPILRFEEAVCSTLKKMRKTNKKIDWNAVDVVCGGNYGLEHLIGKSMGLERFDILAELFHRDFKHLLTKILRHLSAMDLINVISVSTTWRKLLQKDNWAYNAYKLGCKELCEKRAKVSSHTATRDESLCRVPLASVQKVAASSLCTSKKQSKNKNGGLSCNRLAEFIEVAQTLKNDQSLKVCVDCGSPAKHDPCLHRAICTRESCKLDFCTRCSCKYHFSKSCLMSKPGSYRIPSEPLPGSKKSKQNLRRL mint Regulates progression through early mitosis by inhibiting the anaphase promoting complex/cyclosome (APC). Binds to the APC activators cdc20 and fzr1/cdh1 to prevent APC activation. Can also bind directly to the APC to inhibit substrate-binding plk1_xenla Serine/threonine-protein kinase PLK1 plx1 Plx1 Polo-like kinase 1 plk1 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MAQVAGKKLTVAPEAAKPPGIPGSSSAVKEIPEILVDPRTRRRYLRGRFLGKGGFAKCYEITDLESREVFAGKIVPKTMLLKPHQKDKMTMEIAIQRSLDHRHVVGFHGFFEDNDFVYVVLELCRRRSLLELHKRRKAVTEPEARYYLKQTISGCQYLHSNRVIHRDLKLGNLFLNDEMEVKIGDFGLATKVEYDGERKKTLCGTPNYIAPEVLGKKGHSFEVDIWSIGCIMYTLLVGKPPFETSCLKETYMRIKKNEYSIPKHINPVAAALIQKMLRSDPTSRPTIDDLLNDEFFTSGYIPSRLPTTCLTVPPRFSIAPSTIDQSLRKPLTAINKGQDSPLVEKQVAPAKEEEMQQPEFTEPADCYLSEMLQQLTCLNAVKPSERALIRQEEAEDPASIPIFWISKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLIMYNDGDSLQYIERNNTESYLNVRSYPTTLTKKITLLKYFRNYMSEHLLKAGANTTPREGDELARLPFLRTWFRTRSAIILHLSNGTVQINFFQDHTKIILCPLMAAVSYIDEKREFRTYKLSLIQEFGCCKELASRLRYARTMVEKLQSSKSAVAHVKASA trcb_xenla Beta-TrCP fbxw1 btrcp Beta-transducin repeat-containing protein protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MEGFSCSLQPPTASEREDCNRDEPPRKIITEKNTLRQTKLANGTSSMIVPKQRKLSANYEKEKELCVKYFEQWSECDQVEFVEHLISRMCHYQHGHINTYLKPMLQRDFITALPARGLDHIAENILSYLDAKSLCSAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWRGLAERRGWGQYLFKNKPPDGKTPPNSFYRALYPKIIQDIETIESNWRCGRHSLQRIHCRSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRVLMGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPGLA Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Probably recognizes and binds to phosphorylated target proteins. May participate in Wnt signaling mint q9i9k6_xenla Peptidyl-prolyl cis-trans isomerase pin1.L Pin1 pin1 XELAEV_18018988mg protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MADEEKLPPGWEKRMSRSSGRVYYFNHMTNASQWERPIAGGKNGQGEPGKVRCSHLLVKHNQSRRPSSWRQDKITRSKDEALELINGYIQKMKSGDEDFESLASQFSDCSSAKAGGDLGSFGKGAMQKPFEDASFALRPGEMSGPVFTDSGIHIILRTE plk1-fbxo5_a 576221 fbx5a_xenla emi1 576224 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated plk1_xenla Plx1 576225 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait in vitro translated in vitro translated protein in vitro translated physical association physical association false false false F3C mint fbxo5_a-plk1 576221 fbx5a_xenla emi1 576224 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait in vitro translated in vitro translated protein in vitro translated plk1_xenla Plx1 576225 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated physical association physical association false false false F3C mint fbxw1-fbxo5_a 576221 trcb_xenla beta-trcp 576226 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level fbx5a_xenla emi1 576224 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated physical association physical association false false false F3D mint pin1-fbxo5_a 576222 fbx5a_xenla emi1 576224 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level q9i9k6_xenla Pin1 576227 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false F2A F2C mint pin1-fbxo5_a-1 576222 fbx5a_xenla emi1 576224 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate Q90Z80:p.Ser10Arg mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false q9i9k6_xenla Pin1 576227 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F2B mint pin1-fbxo5_a-2 576223 fbx5a_xenla emi1 576224 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level q9i9k6_xenla Pin1 576227 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false F5A mint