IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ ishizaki-2006-1 The mitochondrial electron transfer flavoprotein complex is essential for survival of Arabidopsis in extended darkness. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Ishizaki K., Schauer N., Larson TR., Graham IA., Fernie AR., Leaver CJ. chris.leaver@plants.ox.ac.uk Plant J. (0960-7412) 2006 Only protein-protein interactions imex curation etfb_arath Electron transfer flavoprotein subunit beta, mitochondrial ETFB At5g43430 MWF20.14 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKILVAVKRVVDYAVKIRVKPDKTGVETQNVKMSMNPFCEIALEEALRIKEAGFAKEVIAVSIGPSQCVDTLRTGLAMGADRGIHVETNSIFLPLTIAKILKSLADVENPGLIFLGKQAIDDDCNQTGQMVAALLGWPQATFASKVVLDKDKNVATVDREVDGGLETLNVDLPAVITTDLRLNQPRYASLPNIMKAKSKPIKKMTVQDLKVDIKSDIEILEVTEPPKRKSGVMVSSVDELIDKLKNEAHVV etfa_arath Electron transfer flavoprotein subunit alpha, mitochondrial ETFA F8A12.16 At1g50940 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTRTVLLRALTKNKFVASNAPRSISISITSLSRCISTLILAEHESGTIKPQTVSTVVAANSLGESSSISLLLAGSGSSLQEAASQAASCHPSVSEVLVADSDKFEYSLAEPWAKLVDFVRQQGDYSHILASSSSFGKNILPRVAALLDVSPITDVVKILGSDQFIRPIYAGNALCTVRYTGAGPCMLTIRSTSFPVTPITANSESKKATVSQIDLSNFEDDSVSKSRYVGRSTQDTERPDLGSARVVITGGRALKSVENFKMIEKLAEKLGGAVGATRAAVDAGYVPNDLQVGQTGKIVAPELYMAFGVSGAIQHLAGIKDSKVIVAVNKDADAPIFQVADYGLVGDLFEVIPELLEKLPEKK etf_alpha-etf_beta Interaction between ETF alpha and ETF beta proteins 670043 N/A 670044 unspecified role unspecified role prey prey N/A 670045 unspecified role unspecified role bait bait physical association physical association false false false 1 ETFalpha construct lacked a putative mitochondrial targeting sequence etf_beta-etf_alpha Interaction between ETF beta and ETF alpha proteins 670043 N/A 670044 unspecified role unspecified role bait bait N/A 670045 unspecified role unspecified role prey prey physical association physical association false false false 1 ETFalpha construct lacked a putative mitochondrial targeting sequence