IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ wagner-2006-1 Analysis of the Arabidopsis rsr4-1/pdx1-3 mutant reveals the critical function of the PDX1 protein family in metabolism, development, and vitamin B6 biosynthesis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Wagner S., Bernhardt A., Leuendorf JE., Drewke C., Lytovchenko A., Mujahed N., Gurgui C., Frommer WB., Leistner E., Fernie AR., Hellmann H. hellman@zedat.fu-berlin.de Plant Cell (1040-4651) 2006 wagner-2006-2 Analysis of the Arabidopsis rsr4-1/pdx1-3 mutant reveals the critical function of the PDX1 protein family in metabolism, development, and vitamin B6 biosynthesis. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Wagner S., Bernhardt A., Leuendorf JE., Drewke C., Lytovchenko A., Mujahed N., Gurgui C., Frommer WB., Leistner E., Fernie AR., Hellmann H. hellman@zedat.fu-berlin.de Plant Cell (1040-4651) 2006 pdx11_arath Pyridoxal 5'-phosphate synthase subunit PDX1.1 HEVER-like protein PDX11 PDX1L1 F16M14.16 At2g38230 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAGTGVVAVYGEGAMTETKQKSPFSVKVGLAQMLRGGVIMDVVNAEQARIAEEAGACAVMALERVPADIRAQGGVARMSDPEMIKEIKNAVTIPVMAKARIGHFVEAQILEAIGVDYVDESEVLTLADEDNHINKHNFKIPFVCGCRNLGEALRRIREGAAMIRTKGEAGTGNVVEAVRHVRSVNGAIRLLRSMDDDEVFTYAKKIAAPYDLVVQTKELGRLPVVQFAAGGVATPADAALMMQLGCDGVFVGSGVFKSGDPVKRAKAIVQAVTNYRDAAVLAEVSCGLGEAMVGLNLDDKVERFASRSE pdx13_arath Pyridoxal 5'-phosphate synthase subunit PDX1.3 PDX13 GIP2 PDX1L3 RSR4 T10O8.120 At5g01410 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEGTGVVAVYGNGAITEAKKSPFSVKVGLAQMLRGGVIMDVVNAEQARIAEEAGACAVMALERVPADIRAQGGVARMSDPQMIKEIKQAVTIPVMAKARIGHFVEAQILEAIGIDYIDESEVLTLADEDHHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGEAGTGNIIEAVRHVRSVNGDIRVLRNMDDDEVFTFAKKLAAPYDLVMQTKQLGRLPVVQFAAGGVATPADAALMMQLGCDGVFVGSGIFKSGDPARRARAIVQAVTHYSDPEMLVEVSCGLGEAMVGINLNDEKVERFANRSE pdx12_arath Pyridoxal 5'-phosphate synthase-like subunit PDX1.2 PDX12 A37 PDX1L2 MSL1.3 At3g16050 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADQAMTDQDQGAVTLYSGTAITDAKKNHPFSVKVGLAQVLRGGAIVEVSSVNQAKLAESAGACSVIVSDPVRSRGGVRRMPDPVLIKEVKRAVSVPVMARARVGHFVEAQILESLAVDYIDESEIISVADDDHFINKHNFRSPFICGCRDTGEALRRIREGAAMIRIQGDLTATGNIAETVKNVRSLMGEVRVLNNMDDDEVFTFAKKISAPYDLVAQTKQMGRVPVVQFASGGITTPADAALMMQLGCDGVFVGSEVFDGPDPFKKLRSIVQAVQHYNDPHVLAEMSSGLENAMESLNVRGDRIQDFGQGSV pdx2_arath Probable pyridoxal 5'-phosphate synthase subunit PDX2 PDX2 EMB2407 Protein EMBRYO DEFECTIVE 2407 Pyridoxal 5'-phosphate synthase glutaminase subunit muf9.190 At5g60540 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTVGVLALQGSFNEHIAALRRLGVQGVEIRKADQLLTVSSLIIPGGESTTMAKLAEYHNLFPALREFVKMGKPVWGTCAGLIFLADRAVGQKEGGQELVGGLDCTVHRNFFGSQIQSFEADILVPQLTSQEGGPETYRGVFIRAPAVLDVGPDVEVLADYPVPSNKVLYSSSTVQIQEEDALPETKVIVAVKQGNLLATAFHPELTADTRWHSYFIKMTKEIEQGASSSSSKTIVSVGETSAGPEPAKPDLPIFQ pdx1_3-pdx1_1 Interaction between PDX1.3 and PDX1.1 672500 N/A 672502 unspecified role unspecified role prey prey N/A 672503 unspecified role unspecified role bait bait Q8L940:p.Gly54Ser mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 5B pdx1_3-pdx1_2 Interaction between PDX1.3 and PDX1.2 672500 N/A 672503 unspecified role unspecified role bait bait Q8L940:p.Gly54Ser mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false N/A 672504 unspecified role unspecified role prey prey physical association physical association false false false 5B pdx1_3-pdx1_3 Interaction between PDX1.3 and PDX1.3 672500 N/A 672503 unspecified role unspecified role prey prey N/A 672503 unspecified role unspecified role bait bait Q8L940:p.Gly54Ser mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 5B pdx1_3-pdx2 Interaction between PDX1.3 and PDX2 672500 N/A 672503 unspecified role unspecified role bait bait Q8L940:p.Gly54Ser mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false N/A 672505 unspecified role unspecified role prey prey physical association physical association false false false 5B pdx2-pdx1_1 Interaction between PDX2 and PDX1.1 672500 N/A 672505 unspecified role unspecified role bait bait N/A 672502 unspecified role unspecified role prey prey physical association physical association false false false 5B pdx2-pdx1_3 Interaction between PDX2 and PDX1.3 672500 N/A 672505 unspecified role unspecified role bait bait N/A 672503 unspecified role unspecified role prey prey physical association physical association false false false 5B pdx1_3-pdx1_2-1 Interaction between PDX1.3 and PDX1.2 672501 N/A 672504 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 672503 unspecified role unspecified role bait bait Q8L940:p.Gly54Ser mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 5C pdx1_1-pdx1_2-2 Interaction between PDX1.1 and PDX1.2 672501 N/A 672504 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 672502 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 5C pdx1_2-pdx1_2 PDX1.2 homodimer 672501 N/A 672504 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 672504 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 5C