IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ gullerova-2006-2 AtCyp59 is a multidomain cyclophilin from Arabidopsis thaliana that interacts with SR proteins and the C-terminal domain of the RNA polymerase II. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Gullerova M., Barta A., Lorkovic ZJ. Confocal microscopy analysis was carried out on tobacco protoplasts which transiently expressed epitope tagged fusion proteins. zdravko.lorkovic@univie.ac.at, andrea.barta@univie.ac.at The cDNA library was made from random-primed mRNA, isolated from mature Arabidopsis leaves and roots. RNA (1355-8382) 2006 gullerova-2006-4 AtCyp59 is a multidomain cyclophilin from Arabidopsis thaliana that interacts with SR proteins and the C-terminal domain of the RNA polymerase II. tobac Nicotiana tabacum (Common tobacco) Common tobacco confocal microscopy confocal microscopy predetermined predetermined participant predetermined Gullerova M., Barta A., Lorkovic ZJ. Confocal microscopy analysis was carried out on tobacco protoplasts which transiently expressed epitope tagged fusion proteins. zdravko.lorkovic@univie.ac.at, andrea.barta@univie.ac.at The cDNA library was made from random-primed mRNA, isolated from mature Arabidopsis leaves and roots. RNA (1355-8382) 2006 gullerova-2006-1 AtCyp59 is a multidomain cyclophilin from Arabidopsis thaliana that interacts with SR proteins and the C-terminal domain of the RNA polymerase II. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Gullerova M., Barta A., Lorkovic ZJ. Confocal microscopy analysis was carried out on tobacco protoplasts which transiently expressed epitope tagged fusion proteins. zdravko.lorkovic@univie.ac.at, andrea.barta@univie.ac.at The cDNA library was made from random-primed mRNA, isolated from mature Arabidopsis leaves and roots. RNA (1355-8382) 2006 gullerova-2006-3 AtCyp59 is a multidomain cyclophilin from Arabidopsis thaliana that interacts with SR proteins and the C-terminal domain of the RNA polymerase II. in vitro In vitro crosslink cross-linking study crosslink weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Gullerova M., Barta A., Lorkovic ZJ. Confocal microscopy analysis was carried out on tobacco protoplasts which transiently expressed epitope tagged fusion proteins. The nucleic acid sequence for the Syn7 ribopolymer was obtained from the reference Goodall and Filipowicz (1989) provided in the text. zdravko.lorkovic@univie.ac.at, andrea.barta@univie.ac.at The cDNA library was made from random-primed mRNA, isolated from mature Arabidopsis leaves and roots. RNA (1355-8382) 2006 gullerova-2006-5 AtCyp59 is a multidomain cyclophilin from Arabidopsis thaliana that interacts with SR proteins and the C-terminal domain of the RNA polymerase II. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Gullerova M., Barta A., Lorkovic ZJ. Confocal microscopy analysis was carried out on tobacco protoplasts which transiently expressed epitope tagged fusion proteins. zdravko.lorkovic@univie.ac.at, andrea.barta@univie.ac.at The cDNA library was made from random-primed mRNA, isolated from mature Arabidopsis leaves and roots. RNA (1355-8382) 2006 gullerova-2006-6 AtCyp59 is a multidomain cyclophilin from Arabidopsis thaliana that interacts with SR proteins and the C-terminal domain of the RNA polymerase II. arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Gullerova M., Barta A., Lorkovic ZJ. Confocal microscopy analysis was carried out on tobacco protoplasts which transiently expressed epitope tagged fusion proteins. zdravko.lorkovic@univie.ac.at, andrea.barta@univie.ac.at The cDNA library was made from random-primed mRNA, isolated from mature Arabidopsis leaves and roots. RNA (1355-8382) 2006 cyp59_arath Peptidyl-prolyl cis-trans isomerase CYP59 CYP59 Cyclophilin-59 F22G10.24 At1g53720 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSVLIVTSLGDIVIDLHSDKCPLTCKNFLKLCKIKYYNGCLFHTVQKDFTAQTGDPTGTGAGGDSIYKFLYGEQARFYKDEIHLDLKHSKTGTVAMASGGENLNASQFYFTLRDDLDYLDGKHTVFGQIAEGFDTLTRINEAYVDPKNRPYKNIRIKHTHILDDPFDDPPQLAEMMPDASPEGKPKEEVKDDVRLEDDWVPMDEELGAQELEEVIREKAAHSSAVVLESIGDIPEAEVKPPDNVLFVCKLNPVTEDEDLHTIFSRFGTVVSADVIRDFKTGDSLCYAFIEFENKESCEQAYFKMDNALIDDRRIHVDFSQSVSKLWSQFRQKDSQKGKGNGCFKCGSTDHIAKDCVGGPSSKFIVKDQNRQHGGGEGYEMVFEGDVHETPKHNSHERERSEKIQRRSPHGNGEGKRQHRDERDDGRRQHDREDARELERKHRERKERESREDEDRRRRRRREESRDKESRRERDEDDHRSHRDYKERRRERDDRHGREARHERRDR src33_arath Serine/arginine-rich SC35-like splicing factor SCL33 SCL33 SC35-like splicing factor 33 SR33 Serine/arginine-rich splicing factor 33 F7A10.15 At1g55310 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRGRSYTPSPPRGYGRRGRSPSPRGRYGGRSRDLPTSLLVRNLRHDCRQEDLRKSFEQFGPVKDIYLPRDYYTGDPRGFGFVQFMDPADAADAKHHMDGYLLLGRELTVVFAEENRKKPTEMRARERGGGRFRDRRRTPPRYYSRSRSPPPRRGRSRSRSGDYYSPPPRRHHPRSISPREERYDGRRSYSRSPASDGSRGRSLTPVRGKSRSLSPSPRRSISRSPRRSRSPSPKRNRSVSPRRSISRSPRRSRSPRRSRRSYTPEPARSRSQSPHGGQYDEDRSPSQ src28_arath Serine/arginine-rich SC35-like splicing factor SCL28 SCL28 28 kDa SC35-like splicing factor SC35-like splicing factor 28 Serine/arginine-rich splicing factor 28 F17K4.60 At5g18810 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MARARSRSRSYSPRPRDRSPPRERKGYDDNRLRERPSSRDHESSGPSGLLIRNLPLDARPNDLRDSFERFGPLKDIYLPRNYYTGEPRGFGFVKYRYAEDAAEAMKRMNHKVIGGREIAIVFAEENRKTPQEMRTTNGTSGRHGDYKRTSHRSPRRRYRSHSRSRSPPRRESRHSKVREDDLYSPRRRSRSISRSPLPRNEREYKSRNCRSPREERVLTPIRSRCLSRSRSRSLSR src30_arath Serine/arginine-rich SC35-like splicing factor SCL30 SCL30 SC35-like splicing factor 30 Serine/arginine-rich splicing factor 30 T22E16.120 At3g55460 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRRYSPPYYSPPRRGYGGRGRSPPPPPPRRGYGGGGGGGGRRGSSHGSLLVRNIPLDCRPEELREPFERFGPVRDVYIPRDYYSGQPRGFAFVEFVDAYDAGEAQRSMNRRSFAGREITVVVASESRKRPEEMRVKTRTRSREPSGSRDRSHGRSRSRSISRSRSPRRPSDSRSRYRSRSYSPAPRRRGGPPRGEEDENYSRRSYSPGYEGAAAAAPDRDRNGDNEIREKPGYEAEDRRRGGRAVSRSPSGSRSRSVEVSPR sl30a_arath Serine/arginine-rich SC35-like splicing factor SCL30A SCL30A SC35-like splicing factor 30A Serine/arginine-rich splicing factor 30A K20M4.1 At3g13570 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRGRSYTPSPPRGYGRRGRSPSPRGRFGGSRDSDLPTSLLVRNLRHDCRQEDLRRPFEQFGPVKDIYLPRDYYTGDPRGFGFIQFMDPADAAEAKHQMDGYLLLGRELTVVFAEENRKKPTEMRTRDRGGRSNRFQDRRRSPPRYSRSPPPRRGRRSRSRSRGYNSPPAKRHQSRSVSPQDRRYEKERSYSRSPPHNGSRVRSGSPGRVKSHSRSPRRSVSPRKNRSYTPEQARSQSPVPRQSRSPTPVPRGAQNGDRSPSQ q9fyb1_arath sc35 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSHFGRSGPPDISDTYSLLVLNITFRTTADDLYPLFAKYGKVVDVFIPRDRRTGDSRGFAFVRYKYKDEAHKAVERLDGRVVDGREITVQFAKYGPNAEKISKGRVVEPPPKSRRSRSRSPRRSRSPRRSRSPPRRRSPRRSRSPRRRSRDDYREKDYRKRSRSRSYDRRERHEEKDRDHRRRTRSRSASPDEKRRVRGRYDNESRSHSRSLSASPARRSPRSSSPQKTSPAREVSPDKRSNERSPSPRRSLSPRSPALQKASPSKDMSPERRSNERSPSPGSPAPLRKVDAASRSQSPYAAE sr30_arath Serine/arginine-rich splicing factor SR30 SR30 SF2/ASF-like splicing modulator Srp30 SRP30 Serine-arginine rich RNA binding protein 30 T12M4.19 At1g09140 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSRWNRTIYVGNLPGDIRKCEVEDLFYKYGPIVDIDLKIPPRPPGYAFVEFEDPRDADDAIYGRDGYDFDGCRLRVEIAHGGRRFSPSVDRYSSSYSASRAPSRRSDYRVLVTGLPPSASWQDLKDHMRKAGDVCFSEVFPDRKGMSGVVDYSNYDDMKYAIRKLDATEFRNAFSSAYIRVREYESRSVSRSPDDSKSYRSRSRSRGPSCSYSSKSRSVSPARSISPRSRPLSRSRSLYSSVSRSQSRSKSRSRSRSNSPVSPVISG q9spi1_arath protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSRSSRTVYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPRPPGYAFVEFDDARDAEDAIHGRDGYDFDGHRLRVELAHGGRRSSDDTRGSFNGGGRGGGRGRGDGRGDGGSRGPSRRSEFRVLVTGLPSSASWQDLKDHMRKGGDVCFSQVYRDARGTTGVVDYTCYEDMKYALKKLDDTEFRNAFSNGYVRVREYDSRKDSRSPSRGRSYSKSRSRSRGRSVSRSRSRSRSRSRSPKAKSSRRSPAKSTSRSPGPRSKSRSPSPRRSRSRSRSPLPSVQKEGSKSPSKPSPAKSPIHTRSPSR rsz21_arath Serine/arginine-rich splicing factor RSZ21 RSZ21 RS-containing zinc finger protein 21 RSZP21 SRZ21 T23E23.2 At1g23860 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTRVYVGNLDPRVTERELEDEFKAFGVLRNVWVARRPPGYAFLEFDDERDALDAISALDRKNGWRVELSHKDKGGRGGGGGRRGGIEDSKCYECGELGHFARECRRGRGSVRRRSPSPRRRRSPDYGYARRSISPRGRRSPPRRRSVTPPRRGRSYSRSPPYRGSRRDSPRRRDSPYGRRSPYANGV rsz33_arath Serine/arginine-rich splicing factor RS2Z33 RS2Z33 RS-containing zinc finger protein 33 RSZ33 F3G5.13 At2g37340 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MPRYDDRYGNTRLYVGRLSSRTRTRDLERLFSRYGRVRDVDMKRDYAFVEFGDPRDADDARHYLDGRDFDGSRITVEFSRGAPRGSRDFDSRGPPPGAGRCFNCGVDGHWARDCTAGDWKNKCYRCGERGHIERNCKNSPKKLRRSGSYSRSPVRSRSPRRRRSPSRSLSRSRSYSRSRSPVRRRERSVEERSRSPKRMDDSLSPRARDRSPVLDDEGSPKIIDGSPPPSPKLQKEVGSDRDGGSPQDNGRNSVVSPVVGAGGDSSKEDRSPVDDDYEPNRTSPRGSESP srs31_arath Serine/arginine-rich splicing factor RS31 RS31 RSP31 F21F14.30 At3g61860 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRPVFVGNFEYETRQSDLERLFDKYGRVDRVDMKSGYAFVYFEDERDAEDAIRKLDNFPFGYEKRRLSVEWAKGERGRPRGDAKAPSNLKPTKTLFVINFDPIRTKEHDIEKHFEPYGKVTNVRIRRNFSFVQFETQEDATKALEATQRSKILDRVVSVEYALKDDDERDDRNGGRSPRRSLSPVYRRRPSPDYGRRPSPGQGRRPSPDYGRARSPEYDRYKGPAAYERRRSPDYGRRSSDYGRQRSPGYDRYRSRSPVPRGRP rs40_arath Serine/arginine-rich splicing factor RS40 RS40 RSP35 RSP40 M7J2.130 At4g25500 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKPVFCGNFEYDAREGDLERLFRKYGKVERVDMKAGFAFVYMEDERDAEDAIRALDRFEFGRKGRRLRVEWTKSERGGDKRSGGGSRRSSSSMRPSKTLFVINFDADNTRTRDLEKHFEPYGKIVNVRIRRNFAFIQYEAQEDATRALDASNNSKLMDKVISVEYAVKDDDARGNGHSPERRRDRSPERRRRSPSPYKRERGSPDYGRGASPVAAYRKERTSPDYGRRRSPSPYKKSRRGSPEYGRDRRGNDSPRRRERVASPTKYSRSPNNKRERMSPNHSPFKKESPRNGVGEVESPIERRERSRSSPENGQVESPGSIGRRDSDGGYDGAESPMQKSRSPRSPPADE nrpb1_arath DNA-directed RNA polymerase II subunit RPB1 DNA-directed RNA polymerase II largest subunit DNA-directed RNA polymerase II subunit 1 NRPB1 RPB1 RPB205 RPII F4B14.70 At4g35800 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDTRFPFSPAEVSKVRVVQFGILSPDEIRQMSVIHVEHSETTEKGKPKVGGLSDTRLGTIDRKVKCETCMANMAECPGHFGYLELAKPMYHVGFMKTVLSIMRCVCFNCSKILADEEEHKFKQAMKIKNPKNRLKKILDACKNKTKCDGGDDIDDVQSHSTDEPVKKSRGGCGAQQPKLTIEGMKMIAEYKIQRKKNDEPDQLPEPAERKQTLGADRVLSVLKRISDADCQLLGFNPKFARPDWMILEVLPIPPPPVRPSVMMDATSRSEDDLTHQLAMIIRHNENLKRQEKNGAPAHIISEFTQLLQFHIATYFDNELPGQPRATQKSGRPIKSICSRLKAKEGRIRGNLMGKRVDFSARTVITPDPTINIDELGVPWSIALNLTYPETVTPYNIERLKELVDYGPHPPPGKTGAKYIIRDDGQRLDLRYLKKSSDQHLELGYKVERHLQDGDFVLFNRQPSLHKMSIMGHRIRIMPYSTFRLNLSVTSPYNADFDGDEMNMHVPQSFETRAEVLELMMVPKCIVSPQANRPVMGIVQDTLLGCRKITKRDTFIEKDVFMNTLMWWEDFDGKVPAPAILKPRPLWTGKQVFNLIIPKQINLLRYSAWHADTETGFITPGDTQVRIERGELLAGTLCKKTLGTSNGSLVHVIWEEVGPDAARKFLGHTQWLVNYWLLQNGFTIGIGDTIADSSTMEKINETISNAKTAVKDLIRQFQGKELDPEPGRTMRDTFENRVNQVLNKARDDAGSSAQKSLAETNNLKAMVTAGSKGSFINISQMTACVGQQNVEGKRIPFGFDGRTLPHFTKDDYGPESRGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTSETGYIQRRLVKAMEDIMVKYDGTVRNSLGDVIQFLYGEDGMDAVWIESQKLDSLKMKKSEFDRTFKYEIDDENWNPTYLSDEHLEDLKGIRELRDVFDAEYSKLETDRFQLGTEIATNGDSTWPLPVNIKRHIWNAQKTFKIDLRKISDMHPVEIVDAVDKLQERLLVVPGDDALSVEAQKNATLFFNILLRSTLASKRVLEEYKLSREAFEWVIGEIESRFLQSLVAPGEMIGCVAAQSIGEPATQMTLNTFHYAGVSAKNVTLGVPRLREIINVAKRIKTPSLSVYLTPEASKSKEGAKTVQCALEYTTLRSVTQATEVWYDPDPMSTIIEEDFEFVRSYYEMPDEDVSPDKISPWLLRIELNREMMVDKKLSMADIAEKINLEFDDDLTCIFNDDNAQKLILRIRIMNDEGPKGELQDESAEDDVFLKKIESNMLTEMALRGIPDINKVFIKQVRKSRFDEEGGFKTSEEWMLDTEGVNLLAVMCHEDVDPKRTTSNHLIEIIEVLGIEAVRRALLDELRVVISFDGSYVNYRHLAILCDTMTYRGHLMAITRHGINRNDTGPLMRCSFEETVDILLDAAAYAETDCLRGVTENIMLGQLAPIGTGDCELYLNDEMLKNAIELQLPSYMDGLEFGMTPARSPVSGTPYHEGMMSPNYLLSPNMRLSPMSDAQFSPYVGGMAFSPSSSPGYSPSSPGYSPTSPGYSPTSPGYSPTSPGYSPTSPTYSPSSPGYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPAYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPGYSPTSPSYSPTSPSYGPTSPSYNPQSAKYSPSIAYSPSNARLSPASPYSPTSPNYSPTSPSYSPTSPSYSPSSPTYSPSSPYSSGASPDYSPSAGYSPTLPGYSPSSTGQYTPHEGDKKDKTGKKDASKDDKGNP nop10_arath H/ACA ribonucleoprotein complex subunit 3-like protein T13C7.8 At2g20490 Nucleolar protein 10 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MYLQCYINEKGEKVYTTKKESPLGLATESAHPARFSPDDKYSKQRVLLKKRFGLLPTQNAPLQY rh7_arath DEAD-box ATP-dependent RNA helicase 7 RH7 PRH75 MMI9.2 At5g62190 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MPSLMLSDKKEEKKMKKKMALDTPELDSKKGKKEQKLKLSDSDEEESEKKKSKKKDKKRKASEEEDEVKSDSSSEKKKSSKKVKLGVEDVEVDNPNAVSKFRISAPLREKLKANGIEALFPIQASTFDMVLDGADLVGRARTGQGKTLAFVLPILESLVNGPAKSKRKMGYGRSPSVLVLLPTRELAKQVAADFDAYGGSLGLSSCCLYGGDSYPVQEGKLKRGVDIVVGTPGRIKDHIERQNLDFSYLQFRVLDEADEMLRMGFVEDVELILGKVEDSTKVQTLLFSATLPSWVKNISNRFLKRDQKTIDLVGNDKMKASNSVRHIAIPCNKAAMARLIPDIISCYSSGGQTIIFAETKVQVSELSGLLDGSRALHGEIPQSQREVTLAGFRNGKFATLVATNVAARGLDINDVQLIIQCEPPREVEAYIHRSGRTGRAGNTGVAVTLYDSRKSSVSRIEKEAGIKFEHLAAPQPDEIARSGGMEAAEKVKQVCDSVVPAFLEAAKELLETSGLSAEVLLAKALAKTAGFTEIKKRSLLTSMENYVTLHLEAGKPIYSPSFVYGLLRRVLPDDKVEMIEGLSLTADKTGAVFDVKQSDLDLFIAGAQKSAGSMSLEVVKVMPKLQEREPLPQKRFGGGGRGNRFGGGGGNRFGGGGGRGRGGSGGRGQRY syn7_arath_rna Synthetic RNA oligonucleotide of region of Syn7 gene rna ribonucleic acid RNA rna chemical synthesis Chemical synthesis (Chemical synthesis) CACUCGUGAGGUAAGAUUAUCGAUAUUUAAAUUAUUUAUUUCUUCUUUUCCAUUUUUUUGGCUAACAUUUUCCAUGGUUUUAUGAUAUCAUGCAGGUACGA cyp59-scl33 Interaction between cyp59 protein and SCL33 protein 669669 N/A 669675 unspecified role unspecified role bait bait n terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false c-terminal required to bind necessary binding region required to bind range range range range false ecobb Escherichia coli (strain B / BL21) N/A 669676 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false 3E The coordinates of the deletion mutants used in this study are not provided by the authors. But the authors conclude that the C-terminal RS/RD(E) domain of AtCyp59 is necessary for efficient interaction with all tested SR proteins (Figure 3E). The coordinates for this region are taken from the UniProt entry for this protein (Q6Q151) and provided as fuzzy coordinates. The authors state that "The PPIase domain alone (del1) and in combination with either RRM(del) or RRM and zinc knuckle (del3) were not able to interact with SR proteins in vitro. This demonstrates that the C-terminal RS/RD(E) domain of AtCyp59 is necessary for efficient interaction with all tested SR proteins". The protein sequence provided for Arabidopsis AtCyp59 in Figure 1 differs from the protein sequence present in the UniProt record. The UniProt record has an insertion of the following amino acid sequence 'DFSQ SVSKLWSQFR QKDSQK' between residues 317 to 336. cyp59-scl28 Interaction between cyp59 protein and SCL28 protein 669669 N/A 669677 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 669675 unspecified role unspecified role bait bait c-terminal required to bind necessary binding region required to bind range range range range false n terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false 3E The authors state that "The PPIase domain alone (del1) and in combination with either RRM(del) or RRM and zinc knuckle (del3) were not able to interact with SR proteins in vitro. This demonstrates that the C-terminal RS/RD(E) domain of AtCyp59 is necessary for efficient interaction with all tested SR proteins". The coordinates of the deletion mutants used in this study are not provided by the authors. But the authors conclude that the C-terminal RS/RD(E) domain of AtCyp59 is necessary for efficient interaction with all tested SR proteins (Figure 3E). The coordinates for this region are taken from the UniProt entry for this protein (Q6Q151) and provided as fuzzy coordinates. The protein sequence provided for Arabidopsis AtCyp59 in Figure 1 differs from the protein sequence present in the UniProt record. The UniProt record has an insertion of the following amino acid sequence 'DFSQ SVSKLWSQFR QKDSQK' between residues 317 to 336. cyp59-scl30 Interaction between cyp59 protein and SCL30 protein 669669 N/A 669678 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 669675 unspecified role unspecified role bait bait n terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 3B The protein sequence provided for Arabidopsis AtCyp59 in Figure 1 differs from the protein sequence present in the UniProt record. The UniProt record has an insertion of the following amino acid sequence 'DFSQ SVSKLWSQFR QKDSQK' between residues 317 to 336. Therefore the end point of the c-termini of AtCyp59 is defined as a fuzzy coordinate. cyp59-scl30a Interaction between cyp59 protein and SCL30a protein 669669 N/A 669675 unspecified role unspecified role bait bait n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecobb Escherichia coli (strain B / BL21) N/A 669679 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 3B The protein sequence provided for Arabidopsis AtCyp59 in Figure 1 differs from the protein sequence present in the UniProt record. The UniProt record has an insertion of the following amino acid sequence 'DFSQ SVSKLWSQFR QKDSQK' between residues 317 to 336. cyp59-sc35 Interaction between cyp59 protein and SC35 protein 669669 N/A 669675 unspecified role unspecified role bait bait n terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false c-terminal required to bind necessary binding region required to bind range range range range false ecobb Escherichia coli (strain B / BL21) N/A 669680 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false 3E The authors state that "The PPIase domain alone (del1) and in combination with either RRM(del) or RRM and zinc knuckle (del3) were not able to interact with SR proteins in vitro. This demonstrates that the C-terminal RS/RD(E) domain of AtCyp59 is necessary for efficient interaction with all tested SR proteins". The coordinates of the deletion mutants used in this study are not provided by the authors. But the authors conclude that the C-terminal RS/RD(E) domain of AtCyp59 is necessary for efficient interaction with all tested SR proteins (Figure 3E). The coordinates for this region were deduced from the InterPro graphical view available from the UniProt entry for this protein (Q6Q151) and provided as fuzzy coordinates. The protein sequence provided for Arabidopsis AtCyp59 in Figure 1 differs from the protein sequence present in the UniProt record. The UniProt record has an insertion of the following amino acid sequence 'DFSQ SVSKLWSQFR QKDSQK' between residues 317 to 336. cyp59-srp30 Interaction between cyp59 protein and Srp30 protein 669669 N/A 669675 unspecified role unspecified role bait bait n terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecobb Escherichia coli (strain B / BL21) N/A 669681 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false 3B The protein sequence provided for Arabidopsis AtCyp59 in Figure 1 differs from the protein sequence present in the UniProt record. The UniProt record has an insertion of the following amino acid sequence 'DFSQ SVSKLWSQFR QKDSQK' between residues 317 to 336. cyp59-sf2 Interaction between cyp59 protein and SF2 (Srp34) protein 669669 N/A 669682 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 669675 unspecified role unspecified role bait bait c-terminal required to bind necessary binding region required to bind range range range range false n terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false 3E The coordinates of the deletion mutants used in this study are not provided by the authors. But the authors conclude that the C-terminal RS/RD(E) domain of AtCyp59 is necessary for efficient interaction with all tested SR proteins. The coordinates for this region were deduced from the InterPro graphical view available from the UniProt entry for this protein (Q6Q151) and provided as fuzzy coordinates. The authors state that "The PPIase domain alone (del1) and in combination with either RRM(del) or RRM and zinc knuckle (del3) were not able to interact with SR proteins in vitro. This demonstrates that the C-terminal RS/RD(E) domain of AtCyp59 is necessary for efficient interaction with all tested SR proteins". The protein sequence provided for Arabidopsis AtCyp59 in Figure 1 differs from the protein sequence present in the UniProt record. The UniProt record has an insertion of the following amino acid sequence 'DFSQ SVSKLWSQFR QKDSQK' between residues 317 to 336. cyp59-rszp21 Interaction between cyp59 protein and RSZp21 protein 669669 N/A 669675 unspecified role unspecified role bait bait n terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecobb Escherichia coli (strain B / BL21) N/A 669683 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false 3B The protein sequence provided for Arabidopsis AtCyp59 in Figure 1 differs from the protein sequence present in the UniProt record. The UniProt record has an insertion of the following amino acid sequence 'DFSQ SVSKLWSQFR QKDSQK' between residues 317 to 336. cyp59-rsz33 Interaction between cyp59 protein and RSZ33 protein 669669 N/A 669675 unspecified role unspecified role bait bait c-terminal required to bind necessary binding region required to bind range range range range false n terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecobb Escherichia coli (strain B / BL21) N/A 669684 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false 3E The authors state that "The PPIase domain alone (del1) and in combination with either RRM(del) or RRM and zinc knuckle (del3) were not able to interact with SR proteins in vitro. This demonstrates that the C-terminal RS/RD(E) domain of AtCyp59 is necessary for efficient interaction with all tested SR proteins". The coordinates of the deletion mutants used in this study are not provided by the authors. But the authors conclude that the C-terminal RS/RD(E) domain of AtCyp59 is necessary for efficient interaction with all tested SR proteins (Figure 3E). The coordinates for this region are taken from the UniProt entry for this protein (Q6Q151) and provided as fuzzy coordinates. The protein sequence provided for Arabidopsis AtCyp59 in Figure 1 differs from the protein sequence present in the UniProt record. The UniProt record has an insertion of the following amino acid sequence 'DFSQ SVSKLWSQFR QKDSQK' between residues 317 to 336. cyp59-rsp31 Interaction between cyp59 protein and RSP31 protein 669669 N/A 669675 unspecified role unspecified role bait bait n terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecobb Escherichia coli (strain B / BL21) N/A 669685 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false 3B The protein sequence provided for Arabidopsis AtCyp59 in Figure 1 differs from the protein sequence present in the UniProt record. The UniProt record has an insertion of the following amino acid sequence 'DFSQ SVSKLWSQFR QKDSQK' between residues 317 to 336. cyp59-rsp40 Interaction between cyp59 protein and RSP40 protein 669669 N/A 669675 unspecified role unspecified role bait bait c-terminal required to bind necessary binding region required to bind range range range range false n terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecobb Escherichia coli (strain B / BL21) N/A 669686 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association false false false 3E The coordinates of the deletion mutants used in this study are not provided by the authors. But the authors conclude that the C-terminal RS/RD(E) domain of AtCyp59 is necessary for efficient interaction with all tested SR proteins (Figure 3E). The coordinates for this region are taken from the UniProt entry for this protein (Q6Q151) and provided as fuzzy coordinates. The authors state that "The PPIase domain alone (del1) and in combination with either RRM(del) or RRM and zinc knuckle (del3) were not able to interact with SR proteins in vitro. This demonstrates that the C-terminal RS/RD(E) domain of AtCyp59 is necessary for efficient interaction with all tested SR proteins". The protein sequence provided for Arabidopsis AtCyp59 in Figure 1 differs from the protein sequence present in the UniProt record. The UniProt record has an insertion of the following amino acid sequence 'DFSQ SVSKLWSQFR QKDSQK' between residues 317 to 336 rpb1-cyp59 Interaction between cyp59 protein and RNA Polymerase IIprotein 669669 N/A 669675 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 669687 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false 7 The coordinates of the carboxy-terminal domain of RNA Polymerase II protein used in tis analysis is not provided by the authors , nor is it readily discernable from the UniProt entry for this protein. The protein sequence provided for Arabidopsis AtCyp59 in Figure 1 differs from the protein sequence present in the UniProt record. The UniProt record has an insertion of the following amino acid sequence 'DFSQ SVSKLWSQFR QKDSQK' between residues 317 to 336. cyp59-srp30-1 Colocalisation of cyp59 protein and Srp30 protein 669670 N/A 669675 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 669681 unspecified role unspecified role neutral component neutral component region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false 6 In cells coexpressing SRp30-RFP and AtCyp59-GFP only low levels of colocalization were observed. The protein sequence provided for Arabidopsis AtCyp59 in Figure 1 differs from the protein sequence present in the UniProt record. The UniProt record has an insertion of the following amino acid sequence 'DFSQ SVSKLWSQFR QKDSQK' between residues 317 to 336. cyp59-srp34-1 Colocalisation of cyp59 protein and Srp34 protein 669670 N/A 669682 unspecified role unspecified role neutral component neutral component region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 669675 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false 6 In cells coexpressing SRp34-RFP and AtCyp59-GFP only low levels of colocalization were observed. The protein sequence provided for Arabidopsis AtCyp59 in Figure 1 differs from the protein sequence present in the UniProt record. The UniProt record has an insertion of the following amino acid sequence 'DFSQ SVSKLWSQFR QKDSQK' between residues 317 to 336. cyp59-scl33-1 Partial colocalisation of cyp59 protein and Scl33 protein 669670 N/A 669676 unspecified role unspecified role neutral component neutral component region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 669675 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false 6 In cells coexpressing Scl33-RFP and AtCyp59-GFP only low levels of colocalization were observed. The protein sequence provided for Arabidopsis AtCyp59 in Figure 1 differs from the protein sequence present in the UniProt record. The UniProt record has an insertion of the following amino acid sequence 'DFSQ SVSKLWSQFR QKDSQK' between residues 317 to 336. cyp59-nop10 Colocalisation of cyp59 protein and Nop10 protein 669670 N/A 669675 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 669688 unspecified role unspecified role neutral component neutral component region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false 6 The protein sequence provided for Arabidopsis AtCyp59 in Figure 1 differs from the protein sequence present in the UniProt record. The UniProt record has an insertion of the following amino acid sequence 'DFSQ SVSKLWSQFR QKDSQK' between residues 317 to 336. cyp59-rh7 Colocalisation of cyp59 protein and RH7 (PRH75) protein 669670 N/A 669689 unspecified role unspecified role neutral component neutral component region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 669675 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false 6 The protein sequence provided for Arabidopsis AtCyp59 in Figure 1 differs from the protein sequence present in the UniProt record. The UniProt record has an insertion of the following amino acid sequence 'DFSQ SVSKLWSQFR QKDSQK' between residues 317 to 336. scl33-cyp59 Interaction between SCL33 protein and cyp59 protein 669671 N/A 669675 unspecified role unspecified role prey prey c-terminal binding region binding-associated region binding region certain certain sequence position certain range range false N/A 669676 unspecified role unspecified role bait bait physical association physical association false false false 1 The protein sequence provided for Arabidopsis AtCyp59 in Figure 1 differs from the protein sequence present in the UniProt record. The UniProt record has an insertion of the following amino acid sequence 'DFSQ SVSKLWSQFR QKDSQK' between residues 317 to 336. Therefore the end point of the c-terminus of AtCyp59 is defined as a fuzzy coordinate. cyp59-syn7_rna Interaction between Cyp59 protein and oligonucleotide 669672 N/A 669675 unspecified role unspecified role bait bait n terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecobb Escherichia coli (strain B / BL21) N/A 669690 unspecified role unspecified role prey prey direct interaction direct interaction false false false 4 "Poly(G) and poly(C) were able to compete with the RNA, whereas poly(A) and poly(U) did not show any effect on binding of AtCyp59 to RNA even at a 400-fold molar excess". The authors conclude that "AtCyp59 is an RNA binding cyclophilin with preferences for GC-rich sequences". Poly(G) and poly(C) inhibited interaction between the protein and RNA. The RNA was labelled with radionucleotide phosphorus 32. The protein sequence provided for Arabidopsis AtCyp59 in Figure 1 differs from the protein sequence present in the UniProt record. The UniProt record has an insertion of the following amino acid sequence 'DFSQ SVSKLWSQFR QKDSQK' between residues 317 to 336. cyp59-rpb1 Interaction between Cyp59 protein and RNA Polymerase II protein 669673 N/A 669675 unspecified role unspecified role prey prey N/A 669687 unspecified role unspecified role bait bait physical association physical association false false false 7A The authors specify that the carboxy-terminal domain (CTD) of RNA Polymerase protein interacts with the Peptidyl-prolyl cis-trans isomerase. However they do not give coordinates of the region used in the yeast two hybrid analysis. The protein sequence provided for Arabidopsis AtCyp59 in Figure 1 differs from the protein sequence present in the UniProt record. The UniProt record has an insertion of the following amino acid sequence 'DFSQ SVSKLWSQFR QKDSQK' between residues 317 to 336. cyp59-rpb1-2 Interaction between RNA Polymerase II protein and Cyp59 protein 669674 N/A 669675 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 669687 unspecified role unspecified role prey prey physical association physical association false false false 7C The authors specify that the carboxy-terminal domain (CTD) of RNA Polymerase protein interacts with the Peptidyl-prolyl cis-trans isomerase. However they do not give coordinates of the region used in the yeast two hybrid analysis. The protein sequence provided for Arabidopsis AtCyp59 in Figure 1 differs from the protein sequence present in the UniProt record. The UniProt record has an insertion of the following amino acid sequence 'DFSQ SVSKLWSQFR QKDSQK' between residues 317 to 336.