IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ latijnhouwe-2005-1 An Arabidopsis GRIP domain protein locates to the trans-Golgi and binds the small GTPase ARL1. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Latijnhouwers M., Hawes C., Carvalho C., Oparka K., Gillingham AK., Boevink P. petra.boevink@scri.ac.uk Plant J. (0960-7412) 2005 Only protein-protein interactions imex curation latijnhouwe-2005-2 An Arabidopsis GRIP domain protein locates to the trans-Golgi and binds the small GTPase ARL1. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Latijnhouwers M., Hawes C., Carvalho C., Oparka K., Gillingham AK., Boevink P. petra.boevink@scri.ac.uk Plant J. (0960-7412) 2005 Only protein-protein interactions imex curation grip_arath Protein GRIP GRIP K2A18.10 At5g66030 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSEDKESDVVGEEEESHVIKEDKELNDASNETLTENGDQLLQMIAELRLENDFLRSQFEGLKDEVAQGRSLQKAEQVEADSAQLKQLQEQVASLSREIDVEKQTRVAAEQALEHLREAYSEADAKSQEYSSKFSQVEQKLDQEIKERDEKYADLDAKFTRLHKRAKQRIQEIQKEKDDLDARFREVNETAERASSQHSSMQQELERTRQQANEALKAMDAERQQLRSANNKLRDTIEELRGSLQPKENKIETLQQSLLDKDQILEDLKKQLQAVEERKQIAVTELSAKHQKNLEGLEAQVVDALSERDKAAETISSLQVLLAEKESKIAEMEAAATGEAARLRAAAETLKGELAHLKSENEKEKETWEASCDALKSKLEIAESNYLQAEIEVAKMRSQLGSEMSMQTQILSTKDAELKGAREEINRLQSEFSSYKIRAHALLQKKDMELAAAKDSEQIKSLEEALKEAEKEVYLVSAERDRAQQDLQSALASLEKELEERAGALKDASEQIKSLEVKLDSTVARNQAEKQAWEEDLRVLEETWRRRCEALTAQNEASPAEGIEKELENAKLRNKRMKEEHESVRELADRLIEEKDREISRLVDEMTNLRKSMESKPVWNKSPSQVHHYGNNNTESQQQDVSNLSTSAAEHQILILARQQAQREEELAQTQRHILALQEEIEELERENRLHSQQEAVLKTELREMERKQKREGVDMTYLKNVILKLLETGEVEALLPVVGMLLQFSPEEIQKCQQAYHSSTTAATTTEATPSPASEGSGLSVFSRFSFS arf3_arath ADP-ribosylation factor 3 ARF3 F27A10.8 F27C12.31 At2g24765 ARL1 Protein ARF-LIKE 1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGILFTRMFSSVFGNKEARILVLGLDNAGKTTILYRLQMGEVVSTIPTIGFNVETVQYNNIKFQVWDLGGQTSIRPYWRCYFPNTQAVIYVVDSSDTDRIGVAKEEFHAILEEDELKGAVVLIFANKQDLPGALDDAAVTEALELHKIKSRQWAIFKTCAVKGEGLFEGLDWLSNTLKSGSG arl1-grip Interaction between ARL1 protein and GRIP protein 669297 N/A 669299 unspecified role unspecified role prey prey n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false c-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q8S2T0:p.Tyr717Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false N/A 669300 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P40940:p.Thr31Asn mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false the first 14 amino acds of the ARL1 protein (P40940) were removed to improve solubility of the GST-protein construct. 7 The interaction was dependent on the presence of the non-hydrolysable GTP analogue, GTPgammaS. GDP arl1-grip-1 Interaction between ARL1 protein and GRIP protein 669298 N/A 669299 unspecified role unspecified role bait bait c-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 669300 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false P40940:p.Gln71Leu mutation causing mutation causing an interaction mutation enabling interaction mutation causing mutation causing an interaction certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 7C.d