IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ tarutani-2004-2 Identification of three clones which commonly interact with the kinase domains of highly homologous two receptor-like kinases, RLK902 and RKL1. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Tarutani Y., Sasaki A., Yasuda M., Nakashita H., Yoshida S., Yamaguchi I., Suzuki Y. ayoshi@pgr1.ch.a.u-tokyo.ac.jp Arabidopsis cDNA library Biosci. Biotechnol. Biochem. (0916-8451) 2004 tarutani-2004-3 Identification of three clones which commonly interact with the kinase domains of highly homologous two receptor-like kinases, RLK902 and RKL1. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Tarutani Y., Sasaki A., Yasuda M., Nakashita H., Yoshida S., Yamaguchi I., Suzuki Y. ayoshi@pgr1.ch.a.u-tokyo.ac.jp Biosci. Biotechnol. Biochem. (0916-8451) 2004 tarutani-2004-1 Identification of three clones which commonly interact with the kinase domains of highly homologous two receptor-like kinases, RLK902 and RKL1. in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Tarutani Y., Sasaki A., Yasuda M., Nakashita H., Yoshida S., Yamaguchi I., Suzuki Y. ayoshi@pgr1.ch.a.u-tokyo.ac.jp Biosci. Biotechnol. Biochem. (0916-8451) 2004 rlk90_arath Probable inactive receptor kinase RLK902 At3g17840 RLK902 Receptor-like kinase 902 MEB5.6 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRLFFTPSMSNLSIFFSILLLSLPLPSIGDLAADKSALLSFRSAVGGRTLLWDVKQTSPCNWTGVLCDGGRVTALRLPGETLSGHIPEGIFGNLTQLRTLSLRLNGLTGSLPLDLGSCSDLRRLYLQGNRFSGEIPEVLFSLSNLVRLNLAENEFSGEISSGFKNLTRLKTLYLENNKLSGSLLDLDLSLDQFNVSNNLLNGSIPKSLQKFDSDSFVGTSLCGKPLVVCSNEGTVPSQPISVGNIPGTVEGSEEKKKRKKLSGGAIAGIVIGCVVGLSLIVMILMVLFRKKGNERTRAIDLATIKHHEVEIPGEKAAVEAPENRSYVNEYSPSAVKAVEVNSSGMKKLVFFGNATKVFDLEDLLRASAEVLGKGTFGTAYKAVLDAVTLVAVKRLKDVTMADREFKEKIEVVGAMDHENLVPLRAYYYSGDEKLLVYDFMPMGSLSALLHGNKGAGRPPLNWEVRSGIALGAARGLDYLHSQDPLSSHGNVKSSNILLTNSHDARVSDFGLAQLVSASSTTPNRATGYRAPEVTDPRRVSQKADVYSFGVVLLELLTGKAPSNSVMNEEGMDLARWVHSVAREEWRNEVFDSELMSIETVVSVEEEMAEMLQLGIDCTEQHPDKRPVMVEVVRRIQELRQSGADRVG edr4_arath Protein ENHANCED DISEASE RESISTANCE 4 EDR4 Y-1 K2A11.6 At5g05190 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASQTGQKIRLVRCPKCLKILQEDEDVPVYQCGGCSAILQAKRRNIAPSSTPSAGETERAQANEPQSVPETNNVSSSSGQDTVLPSSPGRSVDQEYEKGRNASMESTEKELDDLELSNGDGTNEIQEQECSLGDSEKNEREDNSRLESHMMNTVAEAAGSGSSSGSLSVDHVVAARASNPSGNSEISPDASPVEEKQSQLDILANKTPSAYDVVAARASNSSGNAEISPDASPVEEKQSQLDYPANKTSSAYDGSESSSDEREGQLLDDDEQWNALQKIRSGKFEMHRYPGYKEQGASSSSPFSENRRNGITTYNERHQNRSLQLEGPGGRLGRQGRRHVTEQLRPDMPFYPRESYTRGSPSHPSHDEFDRYPRAHSLQMPSYAGGMNHDFVDYMYHNNPRARGQGQGSRISGEMGRNHGGWYSGQLHNSYSSYSASPQRPMEQPEYHPRWRREIVSDVEDHQRNRHAGHHHELQTRRLRERQRVAKRHVRPTAGGAPFVSCYSCSENLQLPVDFLIFKRKHHLLRCGTCTTVLRFSLQSRNHLVPAVTHDINANRNSNSTSESPIDKAPSKPEKLRSSVQDEELPVARGSPLHRLMGYSTVSQVFKVSQRPPSI y3721_arath Uncharacterized protein At3g27210 Y-2 At3g27210 K17E12.3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGSSSSSSLNNSPIRADSMVTPESQMTVNDNKNDNVSILSPSVKKSFESPRKSTSIPANNNLTPVKSRWSFSSSKKSFGSKDETFFDSQPWLQSDSDDDFHSVNGDFTPSLGNTPKSSFSDRPPRFHNLIFHEKKPSRGSSSPAPLPRRKKLGELFRDSIREEREESGSSSAISTPYLSGANSREFNDTAIEKEEKKKSNWHHHRCLPGFSSCGGSFMERRKKMSSETPVVAVK y3795_arath Uncharacterized protein At3g17950 MEB5.1 MEB5.17 Y-3 At3g17950 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MQDPHVPSSPTISSVSSSDLDTESTGSFFHDRSITLGTLMGFSFTATMPMPFRASSRRHVSPSVAISRASSSNARRNHQRKRPPSNSAEPEPHRRRKWWRFCRDDDDDAAGNGIHRGTGDSKRSSLGEYLEVERRFGDEAVYNSAEAELEDAVVARYQDQQPVMGERALFADGRVLPPASAEVVTGEGTPVATSLCRFPVSLTGICSGGGG q0wtd7_arath At3g51310 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEYLDRETNKAMAIILVQSVFKNNTHIATADEVDALFELAKGLMKDFDGTIDDEIDEEDFQEEQNLVARLVNKLYIDDPEEMSKIIFTVRKHIVAGGPKRLPLTIPPLVFSALKLIRRLRGGDENPFGDDASATPKRILQLLSETVEVLSDVSAPDLALRLYLQCAQAANNCELETVAYEFFTKAYLLYEEEISDSKAQVTALRLIIGTLQRMRVFNVENRDTLTHKATGYSARLLRKPDQCRAVYECAHLFWADECENLKDGERVVLCLKRAQRIADAVQQMANASRGTSSTGSVSLYVELLNKYLYFLEKGNQQVTGDTIKSLAELIKSETKKVESGAEPFINSTLRYIEFQRQQEDGGMNEKYEKIKMEWFE q94br2_arath AILP1 ATAILP1 T24G5.40 T24G5_40 At5g19140 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MLGIFSGAIVSPPEELVAAGSRTPSPKTTGSTLVNRFVEKNPSAVSVQVGDYVQLAYSHHNESPLRPRSFGAKDEIFCLFQGSLDNLGSLKQQYGLAKNANEVLLVIEAYKTLRDRAPYPANHVVAHLSGDFAFVVFDKSTSTLFVASDQVGKVPLYWGITADGYVAFADDVDLLKGACGKSLASFPQGCYYSTALGGLRSFENPKNKITAVPANEGEIWGATFKVEGATVLAD y1848_arath Probable inactive receptor kinase At1g48480 RKL1 At1g48480 T1N15.9 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRVFFFPNSSMAILSVFLSLLLLSLPLPSTQDLNADRTALLSLRSAVGGRTFRWNIKQTSPCNWAGVKCESNRVTALRLPGVALSGDIPEGIFGNLTQLRTLSLRLNALSGSLPKDLSTSSNLRHLYLQGNRFSGEIPEVLFSLSHLVRLNLASNSFTGEISSGFTNLTKLKTLFLENNQLSGSIPDLDLPLVQFNVSNNSLNGSIPKNLQRFESDSFLQTSLCGKPLKLCPDEETVPSQPTSGGNRTPPSVEGSEEKKKKNKLSGGAIAGIVIGCVVGFALIVLILMVLCRKKSNKRSRAVDISTIKQQEPEIPGDKEAVDNGNVYSVSAAAAAAMTGNGKASEGNGPATKKLVFFGNATKVFDLEDLLRASAEVLGKGTFGTAYKAVLDAVTVVAVKRLKDVMMADKEFKEKIELVGAMDHENLVPLRAYYFSRDEKLLVYDFMPMGSLSALLHGNRGAGRSPLNWDVRSRIAIGAARGLDYLHSQGTSTSHGNIKSSNILLTKSHDAKVSDFGLAQLVGSSATNPNRATGYRAPEVTDPKRVSQKGDVYSFGVVLLELITGKAPSNSVMNEEGVDLPRWVKSVARDEWRREVFDSELLSLATDEEEMMAEMVQLGLECTSQHPDQRPEMSEVVRKMENLRPYSGSDQVNEAD q5m762_arath protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSVCGKLDFKDADFDISTSSPTQCSKGSEHTSFTGSEDSQESDGDETGYIDPTVNDETAVQDFGKSVLSPNSSDDEDKDENPMTQTPIVLIPAIKGSREKYGLSLRKSSVSWGADVYDPPPSIASHTVTRSKKQQQKSKSKDNHRKTGKKGQKSKDNSSSRGGSSKDKKQASRKHSRDKFDWVTQMPIVAASS rlk902-at5g05190 Interaction between RLK902 and At5g05190 672088 N/A 672091 unspecified role unspecified role bait bait region binding region binding-associated region binding region range range range range false N/A 672092 unspecified role unspecified role prey prey physical association physical association false false false The authors do not provide the coordinates of the kinase domain used in this assay. The coordinates presented are from the UniProt entry for this protein. rlk902-at3g27210 Interaction between RLK902 and At3g27210 672088 N/A 672091 unspecified role unspecified role bait bait region binding region binding-associated region binding region range range range range false N/A 672093 unspecified role unspecified role prey prey physical association physical association false false false The authors do not provide the coordinates of the kinase domain used in this assay. The coordinates presented are from the UniProt entry for this protein. rlk902-at3g17950 Interaction between RLK902 and At3g17950 672088 N/A 672091 unspecified role unspecified role bait bait region binding region binding-associated region binding region range range range range false N/A 672094 unspecified role unspecified role prey prey physical association physical association false false false The authors do not provide the coordinates of the kinase domain used in this assay. The coordinates presented are from the UniProt entry for this protein. rlk902-at3g51310 Interaction between RLK902 and At3g51310 672088 N/A 672091 unspecified role unspecified role bait bait region binding region binding-associated region binding region range range range range false N/A 672095 unspecified role unspecified role prey prey physical association physical association false false false The authors do not provide the coordinates of the kinase domain used in this assay. The coordinates presented are from the UniProt entry for this protein. rlk902-at5g19140 Interaction between RLK902 and At5g19140 672088 N/A 672091 unspecified role unspecified role bait bait region binding region binding-associated region binding region range range range range false N/A 672096 unspecified role unspecified role prey prey physical association physical association false false false The authors do not provide the coordinates of the kinase domain used in this assay. The coordinates presented are from the UniProt entry for this protein. rlk1-at5g05190 Interaction of RLK1 and At5g05190 672088 N/A 672097 unspecified role unspecified role bait bait region kinase domain binding region binding-associated region binding region range range range range false N/A 672092 unspecified role unspecified role prey prey physical association physical association false false false The authors do not provide the coordinates of the kinase domain used in this assay. The coordinates presented are from the UniProt entry for this protein. rlk1-at3g27210 Interaction of RLK1 and At3g27210 672088 N/A 672093 unspecified role unspecified role prey prey N/A 672097 unspecified role unspecified role bait bait region kinase domain binding region binding-associated region binding region range range range range false physical association physical association false false false The authors do not provide the coordinates of the kinase domain used in this assay. The coordinates presented are from the UniProt entry for this protein. rlk1-at3g17950 Interaction of RLK1 and At3g17950 672088 N/A 672097 unspecified role unspecified role bait bait region kinase domain binding region binding-associated region binding region range range range range false N/A 672094 unspecified role unspecified role prey prey physical association physical association false false false The authors do not provide the coordinates of the kinase domain used in this assay. The coordinates presented are from the UniProt entry for this protein. rlk1-at2g37480 Interaction of RLK1 and At2g37480 672088 N/A 672097 unspecified role unspecified role bait bait region kinase domain binding region binding-associated region binding region range range range range false N/A 672098 unspecified role unspecified role prey prey physical association physical association false false false The authors do not provide the coordinates of the kinase domain used in this assay. The coordinates presented are from the UniProt entry for this protein. rlk1-at3g17950-1 Interaction of RLK1 and At3g17950 672089 N/A 672094 unspecified role unspecified role prey prey N/A 672097 unspecified role unspecified role bait bait region kinase domain binding region binding-associated region binding region range range range range false physical association physical association false false false The authors do not provide the coordinates of the kinase domain used in this assay. The coordinates presented are from the UniProt entry for this protein. 2 rlk1-at3g27210-1 Interaction of RLK1 and At3g27210 672089 N/A 672097 unspecified role unspecified role bait bait region kinase domain binding region binding-associated region binding region range range range range false N/A 672093 unspecified role unspecified role prey prey physical association physical association false false false The authors do not provide the coordinates of the kinase domain used in this assay. The coordinates presented are from the UniProt entry for this protein. 2 rlk1-at5g05190-1 Interaction of RLK1 and At5g05190 672089 N/A 672097 unspecified role unspecified role bait bait region kinase domain binding region binding-associated region binding region range range range range false N/A 672092 unspecified role unspecified role prey prey physical association physical association false false false The authors do not provide the coordinates of the kinase domain used in this assay. The coordinates presented are from the UniProt entry for this protein. 2 rlk902-at5g05190-1 Interaction between RLK902 and At5g05190 672089 N/A 672091 unspecified role unspecified role bait bait region binding region binding-associated region binding region range range range range false N/A 672092 unspecified role unspecified role prey prey physical association physical association false false false The authors do not provide the coordinates of the kinase domain used in this assay. The coordinates presented are from the UniProt entry for this protein. 2 rlk902-at3g27210-1 Interaction between RLK902 and At3g27210 672089 N/A 672091 unspecified role unspecified role bait bait region binding region binding-associated region binding region range range range range false N/A 672093 unspecified role unspecified role prey prey physical association physical association false false false The authors do not provide the coordinates of the kinase domain used in this assay. The coordinates presented are from the UniProt entry for this protein. 2 rlk902-at3g17950-1 Interaction between RLK902 and At3g17950 672089 N/A 672091 unspecified role unspecified role bait bait region binding region binding-associated region binding region range range range range false N/A 672094 unspecified role unspecified role prey prey physical association physical association false false false The authors do not provide the coordinates of the kinase domain used in this assay. The coordinates presented are from the UniProt entry for this protein. 2 rlk902 Autophosphorylation of RLK902 672090 N/A 672091 putative self putative self putative self putative self region binding region binding-associated region binding region range range range range false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false phosphorylation phosphorylation reaction phosphorylation false true false The authors do not provide the coordinates of the kinase domain used in this assay. The coordinates presented are from the UniProt entry for this protein. Autophosphorylation of protein 1 rlk1 Autophosphorylation of RLK1 672090 N/A 672097 putative self putative self putative self putative self region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region kinase domain binding region binding-associated region binding region range range range range false ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false true false The authors do not provide the coordinates of the kinase domain used in this assay. The coordinates presented are from the UniProt entry for this protein. Autophosphorylation of protein 1