IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ zimmermann-2004-1 Comprehensive identification of Arabidopsis thaliana MYB transcription factors interacting with R/B-like BHLH proteins. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zimmermann IM., Heim MA., Weisshaar B., Uhrig JF. bernd.weisshaar@uni-bielefeld.de Plant J. (0960-7412) 2004 zimmermann-2004-2 Comprehensive identification of Arabidopsis thaliana MYB transcription factors interacting with R/B-like BHLH proteins. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Zimmermann IM., Heim MA., Weisshaar B., Uhrig JF. bernd.weisshaar@uni-bielefeld.de Plant J. (0960-7412) 2004 zimmermann-2004-3 Comprehensive identification of Arabidopsis thaliana MYB transcription factors interacting with R/B-like BHLH proteins. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Zimmermann IM., Heim MA., Weisshaar B., Uhrig JF. bernd.weisshaar@uni-bielefeld.de Arabidopsis whole plant and cell culture cDNA libraries Plant J. (0960-7412) 2004 egl1_arath Transcription factor EGL1 Protein ENHANCER OF GLABRA 3 Basic helix-loop-helix protein 2 BHLH2 EGL3 EGL1 MYC146 At1g63650 F24D7.16 EN30 Transcription factor EN 30 bHLH transcription factor bHLH002 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATGENRTVPDNLKKQLAVSVRNIQWSYGIFWSVSASQPGVLEWGDGYYNGDIKTRKTIQAAEVKIDQLGLERSEQLRELYESLSLAESSASGSSQVTRRASAAALSPEDLTDTEWYYLVCMSFVFNIGEGIPGGALSNGEPIWLCNAETADSKVFTRSLLAKSASLQTVVCFPFLGGVLEIGTTEHIKEDMNVIQSVKTLFLEAPPYTTISTRSDYQEIFDPLSDDKYTPVFITEAFPTTSTSGFEQEPEDHDSFINDGGASQVQSWQFVGEEISNCIHQSLNSSDCVSQTFVGTTGRLACDPRKSRIQRLGQIQEQSNHVNMDDDVHYQGVISTIFKTTHQLILGPQFQNFDKRSSFTRWKRSSSVKTLGEKSQKMIKKILFEVPLMNKKEELLPDTPEETGNHALSEKKRREKLNERFMTLRSIIPSISKIDKVSILDDTIEYLQDLQKRVQELESCRESADTETRITMMKRKKPDDEEERASANCMNSKRKGSDVNVGEDEPADIGYAGLTDNLRISSLGNEVVIELRCAWREGILLEIMDVISDLNLDSHSVQSSTGDGLLCLTVNCKHKGTKIATTGMIQEALQRVAWIC myb75_arath Transcription factor MYB75 MYB75 PAP1 SIAA1 F25P12.92 At1g56650 Myb-related protein 75 Production of anthocyanin pigment 1 protein Suc-induced anthocyanin accumulation locus 1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEGSSKGLRKGAWTTEEDSLLRQCINKYGEGKWHQVPVRAGLNRCRKSCRLRWLNYLKPSIKRGKLSSDEVDLLLRLHRLLGNRWSLIAGRLPGRTANDVKNYWNTHLSKKHEPCCKIKMKKRDITPIPTTPALKNNVYKPRPRSFTVNNDCNHLNAPPKVDVNPPCLGLNINNVCDNSIIYNKDKKKDQLVNNLIDGDNMWLEKFLEESQEVDILVPEATTTEKGDTLAFDVDQLWSLFDGETVKFD myb90_arath Transcription factor MYB90 MYB90 PAP2 T27F4.14 At1g66390 Myb-related protein 90 Production of anthocyanin pigment 2 protein protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEGSSKGLRKGAWTAEEDSLLRLCIDKYGEGKWHQVPLRAGLNRCRKSCRLRWLNYLKPSIKRGRLSNDEVDLLLRLHKLLGNRWSLIAGRLPGRTANDVKNYWNTHLSKKHESSCCKSKMKKKNIISPPTTPVQKIGVFKPRPRSFSVNNGCSHLNGLPEVDLIPSCLGLKKNNVCENSITCNKDDEKDDFVNNLMNGDNMWLENLLGENQEADAIVPEATTAEHGATLAFDVEQLWSLFDGETVELD my113_arath Transcription factor MYB113 MYB113 At1g66370 Myb-related protein 113 T27F4.12 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGESPKGLRKGTWTTEEDILLRQCIDKYGEGKWHRVPLRTGLNRCRKSCRLRWLNYLKPSIKRGKLCSDEVDLVLRLHKLLGNRWSLIAGRLPGRTANDVKNYWNTHLSKKHDERCCKTKMINKNITSHPTSSAQKIDVLKPRPRSFSDKNSCNDVNILPKVDVVPLHLGLNNNYVCESSITCNKDEQKDKLININLLDGDNMWWESLLEADVLGPEATETAKGVTLPLDFEQIWARFDEETLELN my114_arath Transcription factor MYB114 MYB114 At1g66380 Myb-related protein 114 T27F4.13 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEGSSKGLRKGAWTAEEDSLLRQCIGKYGEGKWHQVPLRAGLNRCRKSCRLRWLNYLKPSIKRGKFSSDEVDLLLRLHKLLGNRWSLIAGRLPGRTANDVKNYWNTHLSKKHEPCCKTKIKRINIITPPNTPAQKVDIF myb5_arath Transcription repressor MYB5 MYB5 At3g13540 M2 Myb-related protein 5 AtM2 MRP15.2 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MMSCGGKKPVSKKTTPCCTKMGMKRGPWTVEEDEILVSFIKKEGEGRWRSLPKRAGLLRCGKSCRLRWMNYLRPSVKRGGITSDEEDLILRLHRLLGNRWSLIAGRIPGRTDNEIKNYWNTHLRKKLLRQGIDPQTHKPLDANNIHKPEEEVSGGQKYPLEPISSSHTDDTTVNGGDGDSKNSINVFGGEHGYEDFGFCYDDKFSSFLNSLINDVGDPFGNIIPISQPLQMDDCKDGIVGASSSSLGHD tt2_arath Transcription factor TT2 TT2 MYB123 At5g35550 MOK9.18 Protein TRANSPARENT TESTA 2 Myb-related protein 123 Myb-related transcription factor LBM2-like protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGKRATTSVRREELNRGAWTDHEDKILRDYITTHGEGKWSTLPNQAGLKRCGKSCRLRWKNYLRPGIKRGNISSDEEELIIRLHNLLGNRWSLIAGRLPGRTDNEIKNHWNSNLRKRLPKTQTKQPKRIKHSTNNENNVCVIRTKAIRCSKTLLFSDLSLQKKSSTSPLPLKEQEMDQGGSSLMGDLEFDFDRIHSEFHFPDLMDFDGLDCGNVTSLVSSNEILGELVPAQGNLDLNRPFTSCHHRGDDEDWLRDFTC gl1_arath Trichome differentiation protein GL1 GL1 MYB0 K16N12.17 At3g27920 Protein GLABROUS 1 Protein GLABRA 1 R2R3-MYB transcription factor GL1 Myb-related protein 0 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRIRRRDEKENQEYKKGLWTVEEDNILMDYVLNHGTGQWNRIVRKTGLKRCGKSCRLRWMNYLSPNVNKGNFTEQEEDLIIRLHKLLGNRWSLIAKRVPGRTDNQVKNYWNTHLSKKLVGDYSSAVKTTGEDDDSPPSLFITAATPSSCHHQQENIYENIAKSFNGVVSASYEDKPKQELAQKDVLMATTNDPSHYYGNNALWVHDDDFELSSLVMMNFASGDVEYCL myb23_arath Transcription factor MYB23 MYB23 MPO12.5 At5g40330 Myb-related protein 23 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRMTRDGKEHEYKKGLWTVEEDKILMDYVRTHGQGHWNRIAKKTGLKRCGKSCRLRWMNYLSPNVNRGNFTDQEEDLIIRLHKLLGNRWSLIAKRVPGRTDNQVKNYWNTHLSKKLGLGDHSTAVKAACGVESPPSMALITTTSSSHQEISGGKNSTLRFDTLVDESKLKPKSKLVHATPTDVEVAATVPNLFDTFWVLEDDFELSSLTMMDFTNGYCL wer_arath Transcription factor WER Protein WEREWOLF Myb-related protein 66 WER MYB66 At5g14750 T9L3.50 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRKKVSSSGDEGNNEYKKGLWTVEEDKILMDYVKAHGKGHWNRIAKKTGLKRCGKSCRLRWMNYLSPNVKRGNFTEQEEDLIIRLHKLLGNRWSLIAKRVPGRTDNQVKNYWNTHLSKKLGIKDQKTKQSNGDIVYQINLPNPTETSEETKISNIVDNNNILGDEIQEDHQGSNYLSSLWVHEDEFELSTLTNMMDFIDGHCF bh012_arath Transcription factor MYC1 At4g00480 BHLH12 EN58 MYC1 Transcription factor EN 58 bHLH transcription factor bHLH012 Basic helix-loop-helix protein 12 F6N23.22 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSLTMADGVEAAAGRSKRQNSLLRKQLALAVRSVQWSYAIFWSSSLTQPGVLEWGEGCYNGDMKKRKKSYESHYKYGLQKSKELRKLYLSMLEGDSGTTVSTTHDNLNDDDDNCHSTSMMLSPDDLSDEEWYYLVSMSYVFSPSQCLPGRASATGETIWLCNAQYAENKLFSRSLLARSASIQTVVCFPYLGGVIELGVTELISEDHNLLRNIKSCLMEISAHQDNDDEKKMEIKISEEKHQLPLGISDEDLHYKRTISTVLNYSADRSGKNDKNIRHRQPNIVTSEPGSSFLRWKQCEQQVSGFVQKKKSQNVLRKILHDVPLMHTKRMFPSQNSGLNQDDPSDRRKENEKFSVLRTMVPTVNEVDKESILNNTIKYLQELEARVEELESCMGSVNFVERQRKTTENLNDSVLIEETSGNYDDSTKIDDNSGETEQVTVFRDKTHLRVKLKETEVVIEVRCSYRDYIVADIMETLSNLHMDAFSVRSHTLNKFLTLNLKAKFRGAAVASVGMIKRELRRVIGDLF tt8_arath Transcription factor TT8 TT8 BHLH42 Basic helix-loop-helix protein 42 EN32 Transcription factor EN 32 Protein TRANSPARENT TESTA 8 bHLH transcription factor bHLH042 F17A8.170 At4g09820 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDESSIIPAEKVAGAEKKELQGLLKTAVQSVDWTYSVFWQFCPQQRVLVWGNGYYNGAIKTRKTTQPAEVTAEEAALERSQQLRELYETLLAGESTSEARACTALSPEDLTETEWFYLMCVSFSFPPPSGMPGKAYARRKHVWLSGANEVDSKTFSRAILAKSAKIQTVVCIPMLDGVVELGTTKKVREDVEFVELTKSFFYDHCKTNPKPALSEHSTYEVHEEAEDEEEVEEEMTMSEEMRLGSPDDEDVSNQNLHSDLHIESTHTLDTHMDMMNLMEEGGNYSQTVTTLLMSHPTSLLSDSVSTSSYIQSSFATWRVENGKEHQQVKTAPSSQWVLKQMIFRVPFLHDNTKDKRLPREDLSHVVAERRRREKLNEKFITLRSMVPFVTKMDKVSILGDTIAYVNHLRKRVHELENTHHEQQHKRTRTCKRKTSEEVEVSIIENDVLLEMRCEYRDGLLLDILQVLHELGIETTAVHTSVNDHDFEAEIRAKVRGKKASIAEVKRAIHQVIIHDTNL cpc_arath Transcription factor CPC Protein CAPRICE At2g46410 CPC F11C10.10 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MFRSDKAEKMDKRRRRQSKAKASCSEEVSSIEWEAVKMSEEEEDLISRMYKLVGDRWELIAGRIPGRTPEEIERYWLMKHGVVFANRRRDFFRK etc1_arath MYB-like transcription factor ETC1 ETC1 Protein ENHANCER OF TRY AND CPC 1 F6F3.18 At1g01380 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNTQRKSKHLKTNPTIVASSSEEVSSLEWEEIAMAQEEEDLICRMYKLVGERWDLIAGRIPGRTAEEIERFWVMKNHRRSQLR myb4_arath Transcription repressor MYB4 MYB4 F20M13.180 At4g38620 Myb-related protein 4 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGRSPCCEKAHTNKGAWTKEEDERLVAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINYLRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLINRGIDPTSHRPIQESSASQDSKPTQLEPVTSNTINISFTSAPKVETFHESISFPGKSEKISMLTFKEEKDECPVQEKFPDLNLELRISLPDDVDRLQGHGKSTTPRCFKCSLGMINGMECRCGRMRCDVVGGSSKGSDMSNGFDFLGLAKKETTSLLGFRSLEMK gl3_arath Transcription factor GLABRA 3 Basic helix-loop-helix protein 1 Protein SHAPESHIFTER At5g41315 GL3 BHLH1 MYC6 SST MYC6.2 EN31 Transcription factor EN 31 bHLH transcription factor bHLH001 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATGQNRTTVPENLKKHLAVSVRNIQWSYGIFWSVSASQSGVLEWGDGYYNGDIKTRKTIQASEIKADQLGLRRSEQLSELYESLSVAESSSSGVAAGSQVTRRASAAALSPEDLADTEWYYLVCMSFVFNIGEGMPGRTFANGEPIWLCNAHTADSKVFSRSLLAKSAAVKTVVCFPFLGGVVEIGTTEHITEDMNVIQCVKTSFLEAPDPYATILPARSDYHIDNVLDPQQILGDEIYAPMFSTEPFPTASPSRTTNGFDQEHEQVADDHDSFMTERITGGASQVQSWQLMDDELSNCVHQSLNSSDCVSQTFVEGAAGRVAYGARKSRVQRLGQIQEQQRNVKTLSFDPRNDDVHYQSVISTIFKTNHQLILGPQFRNCDKQSSFTRWKKSSSSSSGTATVTAPSQGMLKKIIFDVPRVHQKEKLMLDSPEARDETGNHAVLEKKRREKLNERFMTLRKIIPSINKIDKVSILDDTIEYLQELERRVQELESCRESTDTETRGTMTMKRKKPCDAGERTSANCANNETGNGKKVSVNNVGEAEPADTGFTGLTDNLRIGSFGNEVVIELRCAWREGVLLEIMDVISDLHLDSHSVQSSTGDGLLCLTVNCKHKGSKIATPGMIKEALQRVAWIC q9c9a5_arath ARABIDOPSIS MYB-LIKE 2 ATMYBL2 MYB-like 2 MYBL2 F23N20.2 F23N20_2 At1g71030 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNKTRLRALSPPSGMQHRKRCRLRGRNYVRPEVKQRNFSKDEDDLILKLHALLGNRWSLIAGRLPGRTDNEVRIHWETYLKRKLVKMGIDPTNHRLHHHTNYISRRHLHSSHKEHETKIISDQSSSVSESCGVTILPIPSTNCSEDSTSTGRSHLPDLNIGLIPAVTSLPALCLQDSSESSTNGSTGQETLLLFR etc2_arath MYB-like transcription factor ETC2 ETC2 Protein ENHANCER OF TRY AND CPC 2 T6B20 T9D9 At2g30420 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDNTNRLRLRRGPSLRQTKFTRSRYDSEEVSSIEWEFISMTEQEEDLISRMYRLVGNRWDLIAGRVVGRKANEIERYWIMRNSDYFSHKRRRLNNSPFFSTSPLNLQENLKL egl3-pap1 Interaction between EGL3 protein and PAP1 protein 672678 N/A 672681 unspecified role unspecified role bait bait N/A 672682 unspecified role unspecified role prey prey physical association physical association false false false 1a 1b Colony growth at 20 millimolar 3-AT (3-amino-1,2,4-triazole). egl3-pap2 Interaction between EGL3 protein and PAP2 protein 672678 N/A 672681 unspecified role unspecified role bait bait N/A 672683 unspecified role unspecified role prey prey physical association physical association false false false 1a 1b Colony growth at 20 millimolar 3-AT (3-amino-1,2,4-triazole). egl3-myb113 Interaction between EGL3 protein and MYB113 protein 672678 N/A 672684 unspecified role unspecified role prey prey N/A 672681 unspecified role unspecified role bait bait physical association physical association false false false 1a 1b Colony growth at 20 millimolar 3-AT (3-amino-1,2,4-triazole). egl3-myb114 Interaction between EGL3 protein and MYB114 protein 672678 N/A 672685 unspecified role unspecified role prey prey N/A 672681 unspecified role unspecified role bait bait physical association physical association false false false 1a 1b Colony growth at 20 millimolar 3-AT (3-amino-1,2,4-triazole). egl3-myb5 Interaction between EGL3 protein and MYB5 protein 672678 N/A 672681 unspecified role unspecified role bait bait N/A 672686 unspecified role unspecified role prey prey physical association physical association false false false 1a 1b Colony growth at 20 millimolar 3-AT (3-amino-1,2,4-triazole). egl3-tt2 Interaction between EGL3 protein and TT2 protein 672678 N/A 672687 unspecified role unspecified role prey prey N/A 672681 unspecified role unspecified role bait bait physical association physical association false false false 1a 1b Colony growth at 20 millimolar 3-AT (3-amino-1,2,4-triazole). egl3-gl1 Interaction between EGL3 protein and GL1 protein 672678 N/A 672688 unspecified role unspecified role prey prey N/A 672681 unspecified role unspecified role bait bait physical association physical association false false false 1a 1b Colony growth at 20 millimolar 3-AT (3-amino-1,2,4-triazole). egl3-myb23 Interaction between EGL3 protein and MYB23 protein 672678 N/A 672689 unspecified role unspecified role prey prey N/A 672681 unspecified role unspecified role bait bait physical association physical association false false false 1a 1b Colony growth at 3 millimolar 3-AT (3-amino-1,2,4-triazole). egl3-wer-1 Interaction between EGL3 protein and WER protein 672678 N/A 672690 unspecified role unspecified role prey prey N/A 672681 unspecified role unspecified role bait bait physical association physical association false false false 1a 1b Colony growth at 3 millimolar 3-AT (3-amino-1,2,4-triazole). bhlh012-pap1 Interaction between BHLH012 protein and PAP1 protein 672678 N/A 672682 unspecified role unspecified role prey prey N/A 672691 unspecified role unspecified role bait bait physical association physical association false false false 1a 1b Colony growth at 20 millimolar 3-AT (3-amino-1,2,4-triazole). bhlh012-pap2 Interaction between BHLH012 protein and PAP2 protein 672678 N/A 672691 unspecified role unspecified role bait bait N/A 672683 unspecified role unspecified role prey prey physical association physical association false false false 1a 1b Colony growth at 20 millimolar 3-AT (3-amino-1,2,4-triazole). bhlh012-myb113 Interaction between BHLH012 protein and MYB113 protein 672678 N/A 672691 unspecified role unspecified role bait bait N/A 672684 unspecified role unspecified role prey prey physical association physical association false false false 1a 1b Colony growth at 20 millimolar 3-AT (3-amino-1,2,4-triazole). bhlh012-myb114 Interaction between BHLH012 protein and MYB114 protein 672678 N/A 672685 unspecified role unspecified role prey prey N/A 672691 unspecified role unspecified role bait bait physical association physical association false false false 1a 1b Colony growth at 20 millimolar 3-AT (3-amino-1,2,4-triazole). bhlh012-myb5 Interaction between BHLH012 protein and MYB5 protein 672678 N/A 672691 unspecified role unspecified role bait bait N/A 672686 unspecified role unspecified role prey prey physical association physical association false false false 1a 1b Colony growth at 20 millimolar 3-AT (3-amino-1,2,4-triazole). bhlh012-tt2-1 Interaction between BHLH012 protein and TT2 protein 672678 N/A 672691 unspecified role unspecified role bait bait N/A 672687 unspecified role unspecified role prey prey physical association physical association false false false 1a 1b Colony growth at 20 millimolar 3-AT (3-amino-1,2,4-triazole). bhlh012-gl1 Interaction between BHLH012 protein and GL1 protein 672678 N/A 672688 unspecified role unspecified role prey prey N/A 672691 unspecified role unspecified role bait bait physical association physical association false false false 1a 1b Colony growth at 20 millimolar 3-AT (3-amino-1,2,4-triazole). bhlh012-myb23 Interaction between BHLH012 protein and MYB23 protein 672678 N/A 672689 unspecified role unspecified role prey prey N/A 672691 unspecified role unspecified role bait bait physical association physical association false false false 1a 1b Colony growth at 3 millimolar 3-AT (3-amino-1,2,4-triazole). bhlh012-wer-2 Interaction between BHLH012 protein and WER protein 672678 N/A 672690 unspecified role unspecified role prey prey N/A 672691 unspecified role unspecified role bait bait physical association physical association false false false 1a 1b Colony growth at 3 millimolar 3-AT (3-amino-1,2,4-triazole). tt8-pap1-1 Interaction between TT8 protein and PAP1 protein 672678 N/A 672682 unspecified role unspecified role prey prey N/A 672692 unspecified role unspecified role bait bait physical association physical association false false false 1a 1b Colony growth at 20 millimolar 3-AT (3-amino-1,2,4-triazole). tt8-pap2-2 Interaction between TT8 protein and PAP2 protein 672678 N/A 672692 unspecified role unspecified role bait bait N/A 672683 unspecified role unspecified role prey prey physical association physical association false false false 1a 1b Colony growth at 20 millimolar 3-AT (3-amino-1,2,4-triazole). tt8-myb113-1 Interaction between TT8 protein and MYB113 protein 672678 N/A 672684 unspecified role unspecified role prey prey N/A 672692 unspecified role unspecified role bait bait physical association physical association false false false 1a 1b Colony growth at 3 millimolar 3-AT (3-amino-1,2,4-triazole). tt8-myb114 Interaction between TT8 protein and MYB114 protein 672678 N/A 672692 unspecified role unspecified role bait bait N/A 672685 unspecified role unspecified role prey prey physical association physical association false false false 1a 1b Colony growth at 3 millimolar 3-AT (3-amino-1,2,4-triazole). tt8-myb5 Interaction between TT8 protein and MYB5 protein 672678 N/A 672692 unspecified role unspecified role bait bait N/A 672686 unspecified role unspecified role prey prey physical association physical association false false false 1a 1b Colony growth at 20 millimolar 3-AT (3-amino-1,2,4-triazole). tt8-tt2 Interaction between TT8 protein and TT2 protein 672678 N/A 672692 unspecified role unspecified role bait bait N/A 672687 unspecified role unspecified role prey prey physical association physical association false false false 1a 1b Colony growth at 3 millimolar 3-AT (3-amino-1,2,4-triazole). bhlh012-pap1-1 Interaction between BHLH012 protein and PAP1 protein 672678 N/A 672691 unspecified role unspecified role bait bait N/A 672682 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 3 It is clear from Figure 3 that the region 100 - 114 amino acid residues is able to interact with the bait protein and form the minimum unit of interaction; the authors conclude that the regions required is 53 - 114 amino acids residues. egl3-pap1-1 Interaction between EGL3 protein and PAP1 protein 672678 N/A 672682 unspecified role unspecified role prey prey N/A 672681 unspecified role unspecified role bait bait physical association physical association false false false 3 It is clear from Figure 3 that the region 100 - 114 amino acid residues is able to interact with the bait protein and form the minimum unit of interaction; the authors conclude that the regions required is 53 - 114 amino acids residues. bhlh012-cpc-1 Interaction between BHLH012 protein and CPC protein 672678 N/A 672691 unspecified role unspecified role bait bait N/A 672693 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 3 egl3-cpc-2 Interaction between EGL3 protein and CPC protein 672678 N/A 672681 unspecified role unspecified role bait bait N/A 672693 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 3 bhlh012-at1g01380-1 Interaction between BHLH012 protein and At1g01380 protein 672678 N/A 672691 unspecified role unspecified role bait bait N/A 672694 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 3 egl3-at1g01380-1 Interaction between EGL3 protein and At1g01380 protein 672678 N/A 672694 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 672681 unspecified role unspecified role bait bait physical association physical association false false false 3 egl3-pap1-2 Interaction between EGL3 protein and PAP1 protein 672678 N/A 672681 unspecified role unspecified role bait bait N/A 672682 unspecified role unspecified role prey prey Q9FE25:p.Leu73Ile mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q9FE25:p.Arg76Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q9FE25:p.Arg76Lys mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q9FE25:p.Arg79Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q9FE25:p.Leu80Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q9FE25:p.Arg91Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q9FE25:p.Arg91Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 7a Quantification of the interaction strength by liquid alpha-galactosidase assays demonstrated that exchanges at positions 73 and 76 had no or only a minor impact on the interaction, whereas mutation of either amino acid position 80 or 91 strongly decreased the interaction bhlh012-myb4 Interaction between BHLH012 protein and MYB4 protein 672678 N/A 672695 unspecified role unspecified role prey prey n-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false N/A 672691 unspecified role unspecified role bait bait physical association physical association false false false 8 tt8-myb4-1 Interaction between TT8 protein and MYB4 protein 672678 N/A 672695 unspecified role unspecified role prey prey n-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false N/A 672692 unspecified role unspecified role bait bait physical association physical association false false false 8 The authors note that there was weaker but significant interaction between MYB4 and TT8 proteins. pap1-egl3 Interaction between PAP1 protein and EGL3 protein 672679 N/A 672682 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 672681 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false 1c pap2-egl3-1 Interaction between PAP2 protein and EGL3 protein 672679 N/A 672681 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 672683 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false 1c pap1-gl3 Interaction between PAP1 protein and GL3 protein 672679 N/A 672696 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 672682 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false 1c pap2-gl3-2 Interaction between PAP2 protein and GL3 protein 672679 N/A 672696 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 672683 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false 1c pap2-bhlh012 Interaction between PAP2 protein and BHLH012 protein 672679 N/A 672691 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 672683 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false 1c pap1-bhlh012 Interaction between PAP1 protein and BHLH012 protein 672679 N/A 672682 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 672691 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false 1c pap1-tt8 Interaction between PAP1 protein and TT8 protein 672679 N/A 672692 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 672682 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false 1c pap2-tt8 Interaction between PAP2 protein and TT8 protein 672679 N/A 672683 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 672692 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false 1c bhlh012-mybl2 Interaction between BHLH012 protein and MYBL2 protein 672680 N/A 672691 unspecified role unspecified role bait bait N/A 672697 unspecified role unspecified role prey prey physical association physical association false false false bhlh012-at1g01380 Interaction between BHLH012 protein and At1g01380 protein 672680 N/A 672691 unspecified role unspecified role bait bait N/A 672694 unspecified role unspecified role prey prey physical association physical association false false false bhlh012-at2g30420 Interaction between BHLH012 protein and At2g30420 protein 672680 N/A 672698 unspecified role unspecified role prey prey N/A 672691 unspecified role unspecified role bait bait physical association physical association false false false bhlh012-cpc Interaction between BHLH012 protein and CPC protein 672680 N/A 672691 unspecified role unspecified role bait bait N/A 672693 unspecified role unspecified role prey prey physical association physical association false false false egl3-mybl2 Interaction between EGL3 protein and MYBL2 protein 672680 N/A 672697 unspecified role unspecified role prey prey N/A 672681 unspecified role unspecified role bait bait physical association physical association false false false egl3-at1g01380 Interaction between EGL3 protein and At1g01380 protein 672680 N/A 672681 unspecified role unspecified role bait bait N/A 672694 unspecified role unspecified role prey prey physical association physical association false false false tt8-mybl2 Interaction between TT8 protein and MYBL2 protein 672680 N/A 672697 unspecified role unspecified role prey prey N/A 672692 unspecified role unspecified role bait bait physical association physical association false false false tt8-cpc Interaction between TT8 protein and CPC protein 672680 N/A 672693 unspecified role unspecified role prey prey N/A 672692 unspecified role unspecified role bait bait physical association physical association false false false