IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ kim-2004c-1 A transcriptional coactivator, AtGIF1, is involved in regulating leaf growth and morphology in Arabidopsis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Kim JH., Kende H. hkende@msu.edu Arabidopsis cDNA library Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2004 Only protein-protein interactions imex curation kim-2004c-2 A transcriptional coactivator, AtGIF1, is involved in regulating leaf growth and morphology in Arabidopsis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Kim JH., Kende H. hkende@msu.edu Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2004 Only protein-protein interactions imex curation Arabidopsis cDNA library kim-2004c-3 A transcriptional coactivator, AtGIF1, is involved in regulating leaf growth and morphology in Arabidopsis. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Kim JH., Kende H. hkende@msu.edu Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2004 Only protein-protein interactions imex curation Arabidopsis cDNA library grf1_arath Growth-regulating factor 1 GRF1 Transcription activator GRF1 T20K9.5 At2g22840 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDLGVRVSGHETVSSPGQTELGSGFSNKQERSGFDGEDCWRSSKLSRTSTDGFSSSPASAKTLSFHQGIPLLRSTTINDPRKGQEHMLSFSSASGKSDVSPYLQYCRNSGYGLGGMMNTSNMHGNLLTGVKGPFSLTQWAELEQQALIYKYITANVPVPSSLLLSLKKSFFPYGSLPPNSFGWGSFHLGFSGGNMDPEPGRCRRTDGKKWRCSRDAVPDQKYCERHINRGRHRSRKPVEGQNGHNTNAAAAASAAAASTAAAVSKAAAGTSAVAMRGSDNNNSLAAAVGTQHHTNNQSTDSLANRVQNSRGASVFPATMNLQSKETHPKQSNNPFEFGLISSDSLLNPSHKQASYATSSKGFGSYLDFGNQAKHAGNHNNVDSWPEELKSDWTQLSMSIPMAPSSPVQDKLALSPLRLSREFDPAIHMGLGVNTEFLDPGKKTNNWIPISWGNNNSMGGPLGEVLNSTTNSPKFGSSPTGVLQKSTFGSLSNSSSASSTIIGDNNNKNGDGKDPLGPTTLMNTSATAPSL gif1_arath GRF1-interacting factor 1 GIF Protein ANGUSTIFOLIA 3 Transcription coactivator GIF1 F4I4.20 At5g28640 GIF1 AN3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MQQHLMQMQPMMAGYYPSNVTSDHIQQYLDENKSLILKIVESQNSGKLSECAENQARLQRNLMYLAAIADSQPQPPSVHSQYGSAGGGMIQGEGGSHYLQQQQATQQQQMTQQSLMAARSSMLYAQQQQQQQPYATLQHQQLHHSQLGMSSSSGGGGSSGLHILQGEAGGFHDFGRGKPEMGSGGGGEGRGGSSGDGGETLYLKSSDDGN gif2_arath GRF1-interacting factor 2 GIF2 Transcription coactivator GIF2 F6F3_1 T25K16.15 At1g01160 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MQQQQSPQMFPMVPSIPPANNITTEQIQKYLDENKKLIMAIMENQNLGKLAECAQYQALLQKNLMYLAAIADAQPPPPTPGPSPSTAVAAQMATPHSGMQPPSYFMQHPQASPAGIFAPRGPLQFGSPLQFQDPQQQQQIHQQAMQGHMGIRPMGMTNNGMQHAMQQPETGLGGNVGLRGGKQDGADGQGKDDGK grf2_arath Growth-regulating factor 2 GRF2 Transcription activator GRF2 T28I19.20 At4g37740 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDIGVHVLGSVTSNENESLGLKELIGTKQDRSGFIGEDCLQRSLKLARTTTRAEEEENLSSSVAAAYCKTMSFHQGIPLMRSASPLSSDSRRQEQMLSFSDKPDALDFSKYVGLDNSSNNKNSLSPFLHQIPPPSYFRSSGGYGSGGMMMNMSMQGNFTGVKGPFTLTQWAELEQQALIYKYITANVPVPSSLLISIKKSFYPYGSLPPSSFGWGTFHLGFAGGNMDPEPGRCRRTDGKKWRCSRDAVPDQKYCERHINRGRHRSRKPVEVQSGQNQTAAAASKAVTTPQQPVVAGNTNRSNARASSNRSLAIGSQYINPSTESLPNNRGVSIYPSTVNLQPKESPVIHQKHRNNNNPFEFGHISSDSLLNPNTAKTYGSSFLDFSSNQEKHSGNHNHNSWPEELTSDWTQLSMSIPIASSSPSSTHNNNNAQEKTTLSPLRLSRELDLSIQTDETTIEPTVKKVNTWIPISWGNSLGGPLGEVLNSTTNSPTFGSSPTGVLQKSTFCSLSNNSSVSSPIAENNRHNGDYFHYTT grf1-gif1 Interaction between GRF1 protein and GIF1 protein 666832 N/A 666835 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 666836 unspecified role unspecified role prey prey physical association physical association false false false grf1-gif2 Interaction between GRF1 protein and GIF2 protein 666832 N/A 666837 unspecified role unspecified role prey prey N/A 666835 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false grf1-gif1-1 Interaction between GRF1 protein and GIF1 protein 666833 N/A 666835 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 666836 unspecified role unspecified role prey prey physical association physical association false false false 2 grf2-gif1 Interaction between GRF2 protein and GIF1 protein 666833 N/A 666836 unspecified role unspecified role prey prey N/A 666838 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 2 gif1-grf1 Interaction between GIF1 protein and GRF1 protein 666834 N/A 666835 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false N/A 666836 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false The coordinates for the GRF1 construct containing the QLQ region was taken from Figure 1, but the authors do not provide the coordinates in the text. 3 grf1-grf1 Interaction between GRF1 protein and GIF1 protein 666834 N/A 666836 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 666835 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false the authors do not provide the coordinates for the SNH domain of the GIF1 protein which interacted with GRF1. It was not possible to determine the coordinates of this domain and therefore this information is missing from this entry. 3