IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ samanta-2004-2 Interactions between ID and OLIG proteins mediate the inhibitory effects of BMP4 on oligodendroglial differentiation. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Samanta J., Kessler JA. jakessler@northwestern.edu Development (0950-1991) 2004 samanta-2004-3 Interactions between ID and OLIG proteins mediate the inhibitory effects of BMP4 on oligodendroglial differentiation. mouse-brain Mus musculus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Samanta J., Kessler JA. Cells were treated with 20ng/ml BMP4 for 12 hours jakessler@northwestern.edu Development (0950-1991) 2004 samanta-2004-1 Interactions between ID and OLIG proteins mediate the inhibitory effects of BMP4 on oligodendroglial differentiation. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Samanta J., Kessler JA. jakessler@northwestern.edu Development (0950-1991) 2004 samanta-2004-4 Interactions between ID and OLIG proteins mediate the inhibitory effects of BMP4 on oligodendroglial differentiation. ecoli Escherichia coli (strain K12) 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Samanta J., Kessler JA. jakessler@northwestern.edu Development (0950-1991) 2004 samanta-2004-5 Interactions between ID and OLIG proteins mediate the inhibitory effects of BMP4 on oligodendroglial differentiation. mouse-brain Mus musculus brain brain Brain [cerebrum] confocal microscopy confocal microscopy immunostaining immunostaining Samanta J., Kessler JA. Cells were treated with BMP4 20ng/ml for 12 hours jakessler@northwestern.edu Development (0950-1991) 2004 id4_mouse DNA-binding protein inhibitor ID-4 Id4 Id-4 Idb4 Inhibitor of DNA binding 4 Inhibitor of differentiation 4 protein protein mouse Mus musculus Mouse MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEPALCLQCDMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPPPAPPLHPAGACPVAPPRTPLTALNTDPAGAVNKQGDSILCR olig1_mouse Oligodendrocyte transcription factor 1 Olig1 Oligodendrocyte-specific bHLH transcription factor 1 protein protein mouse Mus musculus Mouse MYYAISQARVNAAPATMLRPQRPGDVQLGASLYELVGYRQPPISSSSSSSSSTASLLPKPAREKAEAPLAEPRGPAPESGGARADAKEEQQQQQLRRKINSRERKRMQDLNLAMDALREVILPYSAAHCQGAPGRKLSKIATLLLARNYILLLGSSLQELRRALGDGAGPAAPRLLLAGLPLLAAAPGSVLLAPGAVGPPETLRPTKYLSLALDEPPCGQFSLPAGGAGSPGLCSCAVCKFPHLVPAGLGLAAVQAQFSK id2_mouse DNA-binding protein inhibitor ID-2 Id2 Id-2 Idb2 Inhibitor of DNA binding 2 Inhibitor of differentiation 2 protein protein mouse Mus musculus Mouse MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVTKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKVLCG olig2_mouse Oligodendrocyte transcription factor 2 Olig2 protein protein mouse Mus musculus Mouse MDSDASLVSSRPSSPEPDDLFLPARSKGGSSSGFTGGTVSSSTPSDCPPELSSELRGAMGASGAHPGDKLGGGGFKSSSSSTSSSTSSAATSSTKKDKKQMTEPELQQLRLKINSRERKRMHDLNIAMDGLREVMPYAHGPSVRKLSKIATLLLARNYILMLTNSLEEMKRLVSEIYGGHHAGFHPSACGGLAHSAPLPTATAHPAAAAHAAHHPAVHHPILPPAAAAAAAAAAAAAVSSASLPGSGLSSVGSIRPPHGLLKSPSAAAAAPLGGGGGGSGGSGGFQHWGGMPCPCSMCQVPPPHHHVSAMGAGTLPRLTSDAK p15806-1 Transcription factor E2-alpha Tcf3 Alf2 Me2 Tcfe2a Immunoglobulin enhancer-binding factor E12/E47 Transcription factor 3 Transcription factor A1 protein protein mouse Mus musculus Mouse MMNQSQRMAPVGSDKELSDLLDFSMMFPLPVANGKSRPASLGGTQFAGSGLEDRPSSGSWGSSDQNSSSFDPSRTYSEGAHFSDSHSSLPPSTFLGAGLGGKGSERNAYATFGRDTSVGTLSQAGFLPGELSLSSPGPLSPSGIKSSSQYYPSFPSNPRRRAADGGLDTQPKKVRKVPPGLPSSVYPPSSGDSYSRDAAAYPSAKTPSSAYPSPFYVADGSLHPSAELWSTPSQVGFGPMLGDGSSPLPLAPGSSSVGSGTFGGLQQQDRMGYQLHGSEVNGSLPAVSSFSAAPGTYSGTSGHTPPVSGAAAESLLGTRGTTASSSGDALGKALASIYSPDHSSNNFSPSPSTPVGSPQGLPGTSQWPRAGAPSALSPNYDAGLHGLSKMEDRLDEAIHVLRSHAVGTASDLHGLLPGHGALTTSFTGPMSLGGRHAGLVGGSHPEEGLTSGASLLHNHASLPSQPSSLPDLSQRPPDSYSGLGRAGTTAGASEIKREEKEDEEIASVADAEEDKKDLKVPRTRTSPDEDEDDLLPPEQKAEREKERRVANNARERLRVRDINEAFKELGRMCQLHLSSEKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEKVSGVVGDPQLALSAAHPGLGEAHNPAGHL p15806-2 Transcription factor E2-alpha Tcf3 Alf2 Me2 Tcfe2a Immunoglobulin enhancer-binding factor E12/E47 Transcription factor 3 Transcription factor A1 protein protein mouse Mus musculus Mouse MMNQSQRMAPVGSDKELSDLLDFSMMFPLPVANGKSRPASLGGTQFAGSGLEDRPSSGSWGSSDQNSSSFDPSRTYSEGAHFSDSHSSLPPSTFLGAGLGGKGSERNAYATFGRDTSVGTLSQAGFLPGELSLSSPGPLSPSGIKSSSQYYPSFPSNPRRRAADGGLDTQPKKVRKVPPGLPSSVYPPSSGDSYSRDAAAYPSAKTPSSAYPSPFYVADGSLHPSAELWSTPSQVGFGPMLGDGSSPLPLAPGSSSVGSGTFGGLQQQDRMGYQLHGSEVNGSLPAVSSFSAAPGTYSGTSGHTPPVSGAAAESLLGTRGTTASSSGDALGKALASIYSPDHSSNNFSPSPSTPVGSPQGLPGTSQWPRAGAPSALSPNYDAGLHGLSKMEDRLDEAIHVLRSHAVGTASDLHGLLPGHGALTTSFTGPMSLGGRHAGLVGGSHPEEGLTSGASLLHNHASLPSQPSSLPDLSQRPPDSYSGLGRAGTTAGASEIKREEKEDEEIASVADAEEDKKDLKVPRTRTSSTDEVLSLEEKDLRDRERRMANNARERVRVRDINEAFRELGRMCQLHLKSDKAQTKLLILQQAVQVILGLEQQVRERNLNPKAACLKRREEEKVSGVVGDPQLALSAAHPGLGEAHNPAGHL Contains a phosphothreonine at position 528. Contains a phosphoserine at position 533. id4-olig1-1 Interaction between mouse ID4 and OLIG1 detected by coIP 597169 N/A 597174 unspecified role unspecified role bait bait N/A 597175 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 5B id2-olig1-1 Interaction between mouse ID2 and OLIG1 detected by coIP 597169 N/A 597175 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 597176 unspecified role unspecified role bait bait physical association physical association false false false 5B id4-olig2-1 Interaction between mouse ID4 and OLIG2 detected by coIP 597169 N/A 597174 unspecified role unspecified role bait bait N/A 597177 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 5B id2-olig2-1 Interaction between mouse ID2 and OLIG2 detected by coIP 597169 N/A 597176 unspecified role unspecified role bait bait N/A 597177 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 5B e12-olig1-1 Interaction between mouse E12 and OLIG1 detected by coIP 597169 N/A 597178 unspecified role unspecified role bait bait N/A 597175 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 7A e12-olig2-1 Interaction between mouse E12 and OLIG2 detected by coIP 597169 N/A 597178 unspecified role unspecified role bait bait N/A 597177 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 7B olig1-id2-1 Interaction between mouse OLIG1 and ID2 detected by coIP 597170 N/A 597175 unspecified role unspecified role bait bait N/A 597176 unspecified role unspecified role prey prey physical association physical association false false false 6B olig1-id4-2 Interaction between mouse OLIG1 and ID4 detected by coIP 597170 N/A 597174 unspecified role unspecified role prey prey N/A 597175 unspecified role unspecified role bait bait physical association physical association false false false 6B id2-olig1-2 Interaction between mouse ID2 and OLIG1 detected by coIP 597170 N/A 597175 unspecified role unspecified role prey prey N/A 597176 unspecified role unspecified role bait bait physical association physical association false false false 6B id2-olig2-2 Interaction between mouse ID2 and OLIG2 detected by coIP 597170 N/A 597176 unspecified role unspecified role bait bait N/A 597177 unspecified role unspecified role prey prey physical association physical association false false false 6C id4-olig2-2 Interaction between mouse ID4 and OLIG2 detected by coIP 597170 N/A 597174 unspecified role unspecified role bait bait N/A 597177 unspecified role unspecified role prey prey physical association physical association false false false 6C olig1-id4-1 Interaction between mouse OLIG1 and ID4 detected by coIP 597171 N/A 597174 unspecified role unspecified role prey prey N/A 597175 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 5B olig2-id4-1 Interaction between mouse OLIG2 and ID4 detected by coIP 597171 N/A 597174 unspecified role unspecified role prey prey N/A 597177 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 5B olig1-e47-1 Interaction between mouse OLIG1and E47 detected by coIP 597171 N/A 597179 unspecified role unspecified role prey prey N/A 597175 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 7A olig2-e47-1 Interaction between mouse OLIG2 and E47 detected by coIP 597171 N/A 597179 unspecified role unspecified role prey prey N/A 597177 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 7B olig1-id2-2 Interaction between mouse OLIG1 and ID2 detected by bacterial two hybrid 597172 N/A 597175 unspecified role unspecified role bait bait N/A 597176 unspecified role unspecified role prey prey physical association physical association false false false Table 1 olig1-id4-3 Interaction between mouse OLIG1 and ID4 detected by bacterial two hybrid 597172 N/A 597175 unspecified role unspecified role bait bait N/A 597174 unspecified role unspecified role prey prey physical association physical association false false false Table 1 olig2-id2-1 Interaction between mouse OLIG2 and ID2 detected by bacterial two hybrid 597172 N/A 597176 unspecified role unspecified role prey prey N/A 597177 unspecified role unspecified role bait bait physical association physical association false false false Table 1 olig2-id4-2 Interaction between mouse OLIG2 and ID4 detected by bacterial two hybrid 597172 N/A 597174 unspecified role unspecified role prey prey N/A 597177 unspecified role unspecified role bait bait physical association physical association false false false Table 1 olig1-id2-3 Interaction between mouse OLIG1 and ID2 detected by confocal 597173 N/A 597176 unspecified role unspecified role neutral component neutral component N/A 597175 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 6A olig1-id4-4 Interaction between mouse OLIG1 and ID4 detected by confocal 597173 N/A 597175 unspecified role unspecified role neutral component neutral component N/A 597174 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 6A olig2-id2-2 Interaction between mouse OLIG2 and ID2 detected by confocal 597173 N/A 597176 unspecified role unspecified role neutral component neutral component N/A 597177 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 6A olig2-id4-3 Interaction between mouse OLIG2 and ID4 detected by confocal 597173 N/A 597174 unspecified role unspecified role neutral component neutral component N/A 597177 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 6A