IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ rao-2003-1 Metallothionein 2A interacts with the kinase domain of PKCmu in prostate cancer. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Rao PS., Jaggi M., Smith DJ., Hemstreet GP., Balaji KC. Cancer - Interactions investigated in the context of cancer kcbalaji@unmc.edu A prostate cancer cDNA library was used. Biochem. Biophys. Res. Commun. (0006-291X) 2003 Only protein-protein interactions imex curation rao-2003-2 Metallothionein 2A interacts with the kinase domain of PKCmu in prostate cancer. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Rao PS., Jaggi M., Smith DJ., Hemstreet GP., Balaji KC. Cancer - Interactions investigated in the context of cancer kcbalaji@unmc.edu A prostate cancer cDNA library was used. Biochem. Biophys. Res. Commun. (0006-291X) 2003 Only protein-protein interactions imex curation rao-2003-3 Metallothionein 2A interacts with the kinase domain of PKCmu in prostate cancer. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast beta galactosidase beta galactosidase complementation beta galactosidase predetermined predetermined participant predetermined Rao PS., Jaggi M., Smith DJ., Hemstreet GP., Balaji KC. Cancer - Interactions investigated in the context of cancer kcbalaji@unmc.edu A prostate cancer cDNA library was used. Biochem. Biophys. Res. Commun. (0006-291X) 2003 Only protein-protein interactions imex curation rao-2003-4 Metallothionein 2A interacts with the kinase domain of PKCmu in prostate cancer. human-lncap Human caucasian prostate carcinoma lncap Human caucasian prostate adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rao PS., Jaggi M., Smith DJ., Hemstreet GP., Balaji KC. Cancer - Interactions investigated in the context of cancer kcbalaji@unmc.edu A prostate cancer cDNA library was used. Biochem. Biophys. Res. Commun. (0006-291X) 2003 Only protein-protein interactions imex curation rao-2003-5 Metallothionein 2A interacts with the kinase domain of PKCmu in prostate cancer. human-c4_2 Homo sapiens c4-2 androgen-independent prostate cancer cells c4_2 Human androgen-independent prostate cancer cells C4-2 This cell line is also known as C4-2B. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rao PS., Jaggi M., Smith DJ., Hemstreet GP., Balaji KC. Cancer - Interactions investigated in the context of cancer kcbalaji@unmc.edu A prostate cancer cDNA library was used. Biochem. Biophys. Res. Commun. (0006-291X) 2003 Only protein-protein interactions imex curation rao-2003-6 Metallothionein 2A interacts with the kinase domain of PKCmu in prostate cancer. human-lncap Human caucasian prostate carcinoma lncap Human caucasian prostate adenocarcinoma confocal microscopy confocal microscopy antibody detection identification by antibody antibody detection Rao PS., Jaggi M., Smith DJ., Hemstreet GP., Balaji KC. Cancer - Interactions investigated in the context of cancer kcbalaji@unmc.edu A prostate cancer cDNA library was used. Biochem. Biophys. Res. Commun. (0006-291X) 2003 Only protein-protein interactions imex curation rao-2003-7 Metallothionein 2A interacts with the kinase domain of PKCmu in prostate cancer. human-c4_2 Homo sapiens c4-2 androgen-independent prostate cancer cells c4_2 Human androgen-independent prostate cancer cells C4-2 This cell line is also known as C4-2B. confocal microscopy confocal microscopy antibody detection identification by antibody antibody detection Rao PS., Jaggi M., Smith DJ., Hemstreet GP., Balaji KC. Cancer - Interactions investigated in the context of cancer kcbalaji@unmc.edu A prostate cancer cDNA library was used. Biochem. Biophys. Res. Commun. (0006-291X) 2003 Only protein-protein interactions imex curation mt2_human Metallothionein-2 Metallothionein-II Metallothionein-2A MT2A CES1 MT2 protein protein human Homo sapiens Human MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCCA kpcd1_human Serine/threonine-protein kinase D1 nPKC-D1 Protein kinase D Protein kinase C mu type nPKC-mu PRKD1 PKD PKD1 PRKCM protein protein human Homo sapiens Human MSAPPVLRPPSPLLPVAAAAAAAAAALVPGSGPGPAPFLAPVAAPVGGISFHLQIGLSREPVLLLQDSSGDYSLAHVREMACSIVDQKFPECGFYGMYDKILLFRHDPTSENILQLVKAASDIQEGDLIEVVLSASATFEDFQIRPHALFVHSYRAPAFCDHCGEMLWGLVRQGLKCEGCGLNYHKRCAFKIPNNCSGVRRRRLSNVSLTGVSTIRTSSAELSTSAPDEPLLQKSPSESFIGREKRSNSQSYIGRPIHLDKILMSKVKVPHTFVIHSYTRPTVCQYCKKLLKGLFRQGLQCKDCRFNCHKRCAPKVPNNCLGEVTINGDLLSPGAESDVVMEEGSDDNDSERNSGLMDDMEEAMVQDAEMAMAECQNDSGEMQDPDPDHEDANRTISPSTSNNIPLMRVVQSVKHTKRKSSTVMKEGWMVHYTSKDTLRKRHYWRLDSKCITLFQNDTGSRYYKEIPLSEILSLEPVKTSALIPNGANPHCFEITTANVVYYVGENVVNPSSPSPNNSVLTSGVGADVARMWEIAIQHALMPVIPKGSSVGTGTNLHRDISVSISVSNCQIQENVDISTVYQIFPDEVLGSGQFGIVYGGKHRKTGRDVAIKIIDKLRFPTKQESQLRNEVAILQNLHHPGVVNLECMFETPERVFVVMEKLHGDMLEMILSSEKGRLPEHITKFLITQILVALRHLHFKNIVHCDLKPENVLLASADPFPQVKLCDFGFARIIGEKSFRRSVVGTPAYLAPEVLRNKGYNRSLDMWSVGVIIYVSLSGTFPFNEDEDIHDQIQNAAFMYPPNPWKEISHEAIDLINNLLQVKMRKRYSVDKTLSHPWLQDYQTWLDLRELECKIGERYITHESDDLRWEKYAGEQGLQYPTHLINPSASHSDTPETEETEMKALGERVSIL prkd1-mt2a PKCmu interacts with MT 2A in a yeast two hybrid assay 575109 N/A 575116 unspecified role unspecified role prey prey N/A 575117 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false prkd1-mt2a-1 PKCmu kinase domain and C1 domain interact with MT 2A in a yeast two hybrid assay 575110 N/A 575116 unspecified role unspecified role prey prey N/A 575117 unspecified role unspecified role bait bait region C1 domain sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false c-terminal kinase domain (KD) sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false MT 2A did not interact with the kinase mutant (K612W), C2 domain (271-320), or PH domain (409-552). 1 B prkd1-mt2a-2 PKCmu kinase domain and C1 domain interact with MT 2A in a beta-galactosidase assay 575111 N/A 575116 unspecified role unspecified role prey prey N/A 575117 unspecified role unspecified role bait bait region C1 domain sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false c-terminal kinase domain (KD) sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1 B The interaction of MT 2A is stronger with the KD of PKCmu than the C1 domain. mt2a-prkd1 PKCmu coimmunoprecipitates with MT 2A in LNCaP cells 575112 N/A 575116 unspecified role unspecified role bait bait N/A 575117 unspecified role unspecified role prey prey physical association physical association false false false 1 C mt2a-prkd1-1 PKCmu coimmunoprecipitates with MT 2A in C4-2 cells 575113 N/A 575116 unspecified role unspecified role bait bait N/A 575117 unspecified role unspecified role prey prey physical association physical association false false false 1 C mt2a-prkd1-2 PKCmu colocalizes with MT 2A in LNCaP cells 575114 N/A 575116 unspecified role unspecified role neutral component neutral component N/A 575117 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 2 mt2a-prkd1-3 PKCmu colocalizes with MT 2A in C4-2 cells 575115 N/A 575116 unspecified role unspecified role neutral component neutral component N/A 575117 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 2