IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ zhang-2003b-1 A network of redundant bHLH proteins functions in all TTG1-dependent pathways of Arabidopsis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhang F., Gonzalez A., Zhao M., Payne CT., Lloyd A. lloyd@uts.cc.utexas.edu Development (0950-1991) 2003 gl3_arath Transcription factor GLABRA 3 Basic helix-loop-helix protein 1 Protein SHAPESHIFTER At5g41315 GL3 BHLH1 MYC6 SST MYC6.2 EN31 Transcription factor EN 31 bHLH transcription factor bHLH001 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATGQNRTTVPENLKKHLAVSVRNIQWSYGIFWSVSASQSGVLEWGDGYYNGDIKTRKTIQASEIKADQLGLRRSEQLSELYESLSVAESSSSGVAAGSQVTRRASAAALSPEDLADTEWYYLVCMSFVFNIGEGMPGRTFANGEPIWLCNAHTADSKVFSRSLLAKSAAVKTVVCFPFLGGVVEIGTTEHITEDMNVIQCVKTSFLEAPDPYATILPARSDYHIDNVLDPQQILGDEIYAPMFSTEPFPTASPSRTTNGFDQEHEQVADDHDSFMTERITGGASQVQSWQLMDDELSNCVHQSLNSSDCVSQTFVEGAAGRVAYGARKSRVQRLGQIQEQQRNVKTLSFDPRNDDVHYQSVISTIFKTNHQLILGPQFRNCDKQSSFTRWKKSSSSSSGTATVTAPSQGMLKKIIFDVPRVHQKEKLMLDSPEARDETGNHAVLEKKRREKLNERFMTLRKIIPSINKIDKVSILDDTIEYLQELERRVQELESCRESTDTETRGTMTMKRKKPCDAGERTSANCANNETGNGKKVSVNNVGEAEPADTGFTGLTDNLRIGSFGNEVVIELRCAWREGVLLEIMDVISDLHLDSHSVQSSTGDGLLCLTVNCKHKGSKIATPGMIKEALQRVAWIC gl1_arath Trichome differentiation protein GL1 GL1 MYB0 K16N12.17 At3g27920 Protein GLABROUS 1 Protein GLABRA 1 R2R3-MYB transcription factor GL1 Myb-related protein 0 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRIRRRDEKENQEYKKGLWTVEEDNILMDYVLNHGTGQWNRIVRKTGLKRCGKSCRLRWMNYLSPNVNKGNFTEQEEDLIIRLHKLLGNRWSLIAKRVPGRTDNQVKNYWNTHLSKKLVGDYSSAVKTTGEDDDSPPSLFITAATPSSCHHQQENIYENIAKSFNGVVSASYEDKPKQELAQKDVLMATTNDPSHYYGNNALWVHDDDFELSSLVMMNFASGDVEYCL myb75_arath Transcription factor MYB75 MYB75 PAP1 SIAA1 F25P12.92 At1g56650 Myb-related protein 75 Production of anthocyanin pigment 1 protein Suc-induced anthocyanin accumulation locus 1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEGSSKGLRKGAWTTEEDSLLRQCINKYGEGKWHQVPVRAGLNRCRKSCRLRWLNYLKPSIKRGKLSSDEVDLLLRLHRLLGNRWSLIAGRLPGRTANDVKNYWNTHLSKKHEPCCKIKMKKRDITPIPTTPALKNNVYKPRPRSFTVNNDCNHLNAPPKVDVNPPCLGLNINNVCDNSIIYNKDKKKDQLVNNLIDGDNMWLEKFLEESQEVDILVPEATTTEKGDTLAFDVDQLWSLFDGETVKFD myb90_arath Transcription factor MYB90 MYB90 PAP2 T27F4.14 At1g66390 Myb-related protein 90 Production of anthocyanin pigment 2 protein protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEGSSKGLRKGAWTAEEDSLLRLCIDKYGEGKWHQVPLRAGLNRCRKSCRLRWLNYLKPSIKRGRLSNDEVDLLLRLHKLLGNRWSLIAGRLPGRTANDVKNYWNTHLSKKHESSCCKSKMKKKNIISPPTTPVQKIGVFKPRPRSFSVNNGCSHLNGLPEVDLIPSCLGLKKNNVCENSITCNKDDEKDDFVNNLMNGDNMWLENLLGENQEADAIVPEATTAEHGATLAFDVEQLWSLFDGETVELD cpc_arath Transcription factor CPC Protein CAPRICE At2g46410 CPC F11C10.10 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MFRSDKAEKMDKRRRRQSKAKASCSEEVSSIEWEAVKMSEEEEDLISRMYKLVGDRWELIAGRIPGRTPEEIERYWLMKHGVVFANRRRDFFRK try_arath Transcription factor TRY TRY MFH8.14 Protein TRIPTYCHON At5g53200 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDNTDRRRRRKQHKIALHDSEEVSSIEWEFINMTEQEEDLIFRMYRLVGDRWDLIAGRVPGRQPEEIERYWIMRNSEGFADKRRQLHSSSHKHTKPHRPRFSIYPS egl1_arath Transcription factor EGL1 Protein ENHANCER OF GLABRA 3 Basic helix-loop-helix protein 2 BHLH2 EGL3 EGL1 MYC146 At1g63650 F24D7.16 EN30 Transcription factor EN 30 bHLH transcription factor bHLH002 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATGENRTVPDNLKKQLAVSVRNIQWSYGIFWSVSASQPGVLEWGDGYYNGDIKTRKTIQAAEVKIDQLGLERSEQLRELYESLSLAESSASGSSQVTRRASAAALSPEDLTDTEWYYLVCMSFVFNIGEGIPGGALSNGEPIWLCNAETADSKVFTRSLLAKSASLQTVVCFPFLGGVLEIGTTEHIKEDMNVIQSVKTLFLEAPPYTTISTRSDYQEIFDPLSDDKYTPVFITEAFPTTSTSGFEQEPEDHDSFINDGGASQVQSWQFVGEEISNCIHQSLNSSDCVSQTFVGTTGRLACDPRKSRIQRLGQIQEQSNHVNMDDDVHYQGVISTIFKTTHQLILGPQFQNFDKRSSFTRWKRSSSVKTLGEKSQKMIKKILFEVPLMNKKEELLPDTPEETGNHALSEKKRREKLNERFMTLRSIIPSISKIDKVSILDDTIEYLQDLQKRVQELESCRESADTETRITMMKRKKPDDEEERASANCMNSKRKGSDVNVGEDEPADIGYAGLTDNLRISSLGNEVVIELRCAWREGILLEIMDVISDLNLDSHSVQSSTGDGLLCLTVNCKHKGTKIATTGMIQEALQRVAWIC ttg1_arath Protein TRANSPARENT TESTA GLABRA 1 TTG1 At5g24520 T31K7.8 K18P6_4 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDNSAPDSLSRSETAVTYDSPYPLYAMAFSSLRSSSGHRIAVGSFLEDYNNRIDILSFDSDSMTVKPLPNLSFEHPYPPTKLMFSPPSLRRPSSGDLLASSGDFLRLWEINEDSSTVEPISVLNNSKTSEFCAPLTSFDWNDVEPKRLGTCSIDTTCTIWDIEKSVVETQLIAHDKEVHDIAWGEARVFASVSADGSVRIFDLRDKEHSTIIYESPQPDTPLLRLAWNKQDLRYMATILMDSNKVVILDIRSPTMPVAELERHQASVNAIAWAPQSCKHICSGGDDTQALIWELPTVAGPNGIDPMSVYSAGSEINQLQWSSSQPDWIGIAFANKMQLLRV gl1-gl3-1 Interaction between GL1 and GL3 protein 672250 N/A 672251 unspecified role unspecified role prey prey n-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 672252 unspecified role unspecified role bait bait n-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false 672263 672261 physical association physical association false false false Table 2 pap1-gl3-2 Interaction between PAP1 and GL3 protein 672250 N/A 672251 unspecified role unspecified role prey prey n-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 672253 unspecified role unspecified role bait bait n-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 2 pap2-gl3-3 Interaction between PAP2 and GL3 protein 672250 N/A 672251 unspecified role unspecified role prey prey n-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 672254 unspecified role unspecified role bait bait n-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false 672273 672271 physical association physical association false false false Table 2 cpc-gl3 Interaction between CPC and GL3 protein 672250 N/A 672251 unspecified role unspecified role prey prey n-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 672255 unspecified role unspecified role bait bait physical association physical association false false false Table 2 try-gl3 Interaction between TRY and GL3 protein 672250 N/A 672251 unspecified role unspecified role prey prey n-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 672256 unspecified role unspecified role bait bait physical association physical association false false false Table 2 gl3-gl3-1 GL3 protein homodimer 672250 N/A 672251 unspecified role unspecified role bait bait c-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 672251 unspecified role unspecified role prey prey c-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false 672286 672284 physical association physical association false false false Table 2 egl3-gl3 Interaction between EGL3 protein and GL3 protein 672250 N/A 672251 unspecified role unspecified role prey prey c-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 672257 unspecified role unspecified role bait bait c-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 2 ttg1-gl3 Interaction between TTG1 protein and GL3 protein 672250 N/A 672258 unspecified role unspecified role bait bait N/A 672251 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 2 gl1-egl3 Interaction between GL1 protein and EGL3 protein 672250 N/A 672252 unspecified role unspecified role bait bait n-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 672257 unspecified role unspecified role prey prey n-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 2 pap1-egl3-1 Interaction between PAP1 protein and EGL3 protein 672250 N/A 672257 unspecified role unspecified role prey prey n-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 672253 unspecified role unspecified role bait bait n-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false 672305 672303 physical association physical association false false false Table 2 pap2-egl3 Interaction between PAP2 protein and EGL3 protein 672250 N/A 672254 unspecified role unspecified role bait bait n-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 672257 unspecified role unspecified role prey prey n-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 2 cpc-egl3 Interaction between CPC protein and EGL3 protein 672250 N/A 672257 unspecified role unspecified role prey prey n-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 672255 unspecified role unspecified role bait bait physical association physical association false false false Table 2 try-egl3 Interaction between TRY protein and EGL3 protein 672250 N/A 672257 unspecified role unspecified role prey prey n-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 672256 unspecified role unspecified role bait bait physical association physical association false false false Table 2 gl3-egl3-1 Interaction between GL3 protein and EGL3 protein 672250 N/A 672257 unspecified role unspecified role prey prey c-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 672251 unspecified role unspecified role bait bait c-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 2 egl3-egl3 EGL3 protein homodimer 672250 N/A 672257 unspecified role unspecified role prey prey c-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 672257 unspecified role unspecified role bait bait c-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 2 ttg1-egl3-1 Interaction between TTG1 protein and EGL3 protein 672250 N/A 672257 unspecified role unspecified role prey prey n-terminal binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 672258 unspecified role unspecified role bait bait physical association physical association false false false Table 2