UniProt UniProt http://www.uniprot.org lin-2003a-1 C. elegans PAT-6/actopaxin plays a critical role in the assembly of integrin adhesion complexes in vivo. caeel-embryo Caenorhabditis elegans embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Lin X., Qadota H., Moerman DG., Williams BD. bdwillms@uiuc.edu Curr. Biol. (0960-9822) 2003 lin-2003a-3 C. elegans PAT-6/actopaxin plays a critical role in the assembly of integrin adhesion complexes in vivo. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lin X., Qadota H., Moerman DG., Williams BD. bdwillms@uiuc.edu Curr. Biol. (0960-9822) 2003 lin-2003a-4 C. elegans PAT-6/actopaxin plays a critical role in the assembly of integrin adhesion complexes in vivo. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 3 hybrid three hybrid 3-hybrid tri hybrid tri-hybrid assay 3 hybrid predetermined predetermined participant predetermined Lin X., Qadota H., Moerman DG., Williams BD. bdwillms@uiuc.edu Curr. Biol. (0960-9822) 2003 lin-2003a-2 C. elegans PAT-6/actopaxin plays a critical role in the assembly of integrin adhesion complexes in vivo. caeel Caenorhabditis elegans fluorescence imaging fluorescence microscopy fluorescence imaging tag visualisation tag visualisation Lin X., Qadota H., Moerman DG., Williams BD. bdwillms@uiuc.edu Curr. Biol. (0960-9822) 2003 pat3_caeel Integrin beta pat-3 pat-3 ZK1058.2 Paralyzed arrest at two-fold protein 3 protein protein caeel Caenorhabditis elegans MPPSTSLLLLAALLPFALPASDWKTGEVTGKVVEKSEFPCYSLSRDNYTCSACIQYHESCAWCGAPMFDEKKPYARCDSRAKLMEHGCPNSYIEDPATKLDITEDSKLSDQGQVESEEEAVQIKPQEMYVEIRPKSRVRFNVTYRQAVDYPVDLYYLMDLSYSMKDDKQKLSELGDLLAERMRTVTKNFRLGFGSFIDKKLMPFIDPRIEKQLSPCPTPCAEPYGFKHQMSLTTNTAKFKAEVDKAEISGNLDAPEGGFDAVVQALACNKTIGWRERARKMIVFSTDAGFHFAGDGRLAGVVEPNDGTCHLDREGYYTETLNQDYPSIALLHQMIKDRKANVIFAVTKNNQDLYTQLSNALPDVSSSVGVLANDSRNIVDLIEKEYLKISEKIIMVDNANASEGLKLTYRSMCLDGTTLKDTNVCEGIRVGDEVQFEVTLENTHCIDKRDFVLRIGPSGLDETLIVNVKVLCDCDCERQDRIVTNSADCNGGDMVCGVCRCKGGNVGKYCECNRPGMSTAALNEKCKRTNESAICEGRGVCNCGRCECNPRANPEEQISGEFCECDNFNCPRHDRKICAEHGECNCGKCICAPGWTGRACECPISTDSCLSANGKICNGKGECICGRCRCFDSPDGNRYSGAKCEICPTCPTKCVEYKNCVMCQQWQTGPLNETACDQCEFKVIPVEELPNLNETTPCQFVDPADDCTFYYLYYYDEATDNATVWVRKHKDCPPPVPVLAIVLGVIAGIVILGILLLLLWKLLTVLHDRSEYATFNNERLMAKWDTNENPIYKQATTTFKNPVYAGKAN parv_caeel Paralyzed arrest at two-fold protein 6 pat-6 T21D12.4 Actopaxin homolog Parvin-like protein protein protein caeel Caenorhabditis elegans MSTLGRSKTPSRDEPKKPGVFEKLSGTLSRKKKAPEDEHGNQGGAHHATDEDEVLELELEGREALDQSLVPVLARNIWLEEGEIRRYLTKETARDQKLAQVVDLLIYWLNEELADQRIVVRHLQEDLFDGQIIQKLLEKLEQIRIEVPEVSQSEEGQRQKLQIVVQTANRILGQPREQEKWSADLIHQKDFTAIIQLLVLLALHYRAPVRFPDNVVANVVVAQKEHGQVKTHRITEQITTVQTELAPKGTRDAFDTLFDYGPDKLAHVKTSLLAFCNKHLNKINLEVSDLDNQFQDGVFLVLLVGLLEGYFVPLYHFNLQVQSHEEKVKNVQFAFKLMEDTGLEKPRSRVQDIANGDVKSTLRLLHLLFTKYKHI ilkh_caeel Integrin-linked protein kinase homolog pat-4 pat-4 Paralyzed and arrested elongation at two-fold protein 4 C29F9.7 protein protein caeel Caenorhabditis elegans MSLSTHYHAHKPNVPIIMEDVFGWVREGNAFQVRVWLDDHEHDLNVGDDHAFSLLHWAAKGGHVAIAEMLLSRGARVNSTNMGDDTSLHLAAAHGHRQIVVKLLSRKADVNATNEHGMTPLHYACFWGYEQIAEDLISCGAAVNVCNKKGMTPLDVCQPMCKNTILEIAQEHGQSPNDRVPFKDTTWKGTKSRTRDATLSRYTGVDVSSLNLITKIAESHSGELWRGKWQGNDIVARILNVQEVTARISRDFQTEFPALRIFAHPNICAVLAAANQPPNLVIISQYMPFGSLYNVLHEQSSVVIDHGQAVRFALDIARGMSYLHSLDPMLLRFYLSSKHVVVDEELTAKLSMADTKFSFQEVGKAYSPAWMSPEALSRAPEDLNIRAADMWSFAILLWELNTREVPFSDLPPMECGMKIALEGLRVHIPPGIARNMNRLMNICMNEDPGRRPNFDQIIPILERMIL un112_caeel Protein unc-112 Uncoordinated protein 112 Mitogen-inducible mig-2 protein-like unc-112 C47E8.7 protein protein caeel Caenorhabditis elegans MAHLVEGTSIIDGKWQLPILVTDLNIQRSISVLGNLNVGGLMLELVSECDVERDWSDHALWWPEKRRWLQHTRSTLDQNGITAETQLEFTPMHKEARIQLPDMQMIDARVDFSVNSFKATKKLCRDLGIRYSEELSLKRYIPPEDLRRGTSDADNMNGPLSMRPGEESVGPMTLRKAAPIFASQSNLDMRRRGQSPALSQSGHIFNAHEMGTLPRHGTLPRGVSPSPGAYNDTMRRTPIMPSISFSEGLENEQFDDALIHSPRLAPSRDTPVFRPQNYVEKAAINRGWLDSSRSLMEQGIFEGDIILLRFKFMNFFDLNPKYDPVRINQLYEQAKWSILLDEFDHTEEEATLFAALQLQATLQRDSPEPEENNKDDVDILLDELEQNLDAAALNRRSDLTQVPELADYLKYMKPKKLAAFKGFKRAFFSFRDLYLSYHQSSSDVNSAPLGHFSLKGCEVSQDVSVGQQKYHIKLLLPTAEGMIDFILKCDSEHQYARWMAACRLASRGKSMADSSYQQEVESIKNLLKMQSGNGNENGNSNTASRKAAAVKLPNDFNVDEYISSKYVRRARSKQQIQQRVSDAHGNVRQLTATEAKLQYIRAWQALPEHGIHYFIVRFRNARKAELVAVAVNRLAKLNMDNGESLKTWRFANMKKWHVNWEIRHLKIQFEDEDIEFKPLSADCKVVHEFIGGYIFLSMRSKEHSQNLDEELFHKLTGGWA pat6-pat3-1 682695 N/A 682699 unspecified role unspecified role neutral component neutral component N/A 682700 unspecified role unspecified role neutral component neutral component c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Fig 3A-3C pat6-pat4-1 682695 N/A 682701 unspecified role unspecified role neutral component neutral component N/A 682700 unspecified role unspecified role neutral component neutral component c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Fig 3D-3F pat6-pat4-2 682696 N/A 682701 unspecified role unspecified role prey prey N/A 682700 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig 5A pat4-pat6-1 682696 N/A 682701 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 682700 unspecified role unspecified role prey prey physical association physical association false false false Fig 5B pat6-pat4-3 682697 N/A 682702 unspecified role unspecified role prey prey N/A 682701 unspecified role unspecified role prey prey n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 682700 unspecified role unspecified role bait bait physical association physical association false false false Fig 5C unc112-pat6-1 682697 N/A 682701 unspecified role unspecified role prey prey n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 682702 unspecified role unspecified role bait bait N/A 682700 unspecified role unspecified role prey prey physical association physical association false false false Fig 5C pat6-pat3-2 682698 N/A 682699 unspecified role unspecified role neutral component neutral component c-terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 682700 unspecified role unspecified role neutral component neutral component c-terminus cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Fig 3H-3J