IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ di_palma-2003-3 The paired domain-containing factor Pax8 and the homeodomain-containing factor TTF-1 directly interact and synergistically activate transcription. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Di Palma T., Nitsch R., Mascia A., Nitsch L., Di Lauro R., Zannini M. stella@alpha.szn.it 2007-03-27: S Zannini, Istituto di Endocrinologia ed Oncologia Sperimentale del C.N.R., c/o Dipartimento di Biologia e Patologia Cellulare e Molecolare, Universita' degli Studi di Napoli Federico II, via Pansini 5, 80131 Napoli, Italy - request for 3 published papers to be curated. J. Biol. Chem. (0021-9258) 2003 di_palma-2003-1 The paired domain-containing factor Pax8 and the homeodomain-containing factor TTF-1 directly interact and synergistically activate transcription. rat-pc-cl3 Rat thyroid epithelial cells pc-cl3 Rat thyroid epithelial cells confocal microscopy confocal microscopy immunostaining immunostaining Di Palma T., Nitsch R., Mascia A., Nitsch L., Di Lauro R., Zannini M. stella@alpha.szn.it 2007-03-27: S Zannini, Istituto di Endocrinologia ed Oncologia Sperimentale del C.N.R., c/o Dipartimento di Biologia e Patologia Cellulare e Molecolare, Universita' degli Studi di Napoli Federico II, via Pansini 5, 80131 Napoli, Italy - request for 3 published papers to be curated. J. Biol. Chem. (0021-9258) 2003 di_palma-2003-2 The paired domain-containing factor Pax8 and the homeodomain-containing factor TTF-1 directly interact and synergistically activate transcription. rat-pc-cl3 Rat thyroid epithelial cells pc-cl3 Rat thyroid epithelial cells anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Di Palma T., Nitsch R., Mascia A., Nitsch L., Di Lauro R., Zannini M. stella@alpha.szn.it 2007-03-27: S Zannini, Istituto di Endocrinologia ed Oncologia Sperimentale del C.N.R., c/o Dipartimento di Biologia e Patologia Cellulare e Molecolare, Universita' degli Studi di Napoli Federico II, via Pansini 5, 80131 Napoli, Italy - request for 3 published papers to be curated. J. Biol. Chem. (0021-9258) 2003 pax8_rat Paired box protein Pax-8 Pax8 Pax-8 protein protein rat Rattus norvegicus (Rat) Rat MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDNKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDTFGQHHLEPLECPFERQHYPEAYASPSHTKGEQGLYPLPLLNSTLDDGKATLTPSNTPLGRNLSTHQTYPVVADPHSPYAIKQETPELSSSSSTPSSLSSSAFLDLQQVGSGGPAGASVPPFNAFSHAASVYGQFTGQALLSGREMVGPTLPGYPPHIPTSGQGSYASSAIAGMVAGSEYSGNAYSHTPYASYSEAWRFPNSSLLSSPYYYSSTTRPSAPPTSATAFDHL nkx21_rat Homeobox protein Nkx-2.1 Nkx2-1 Nkx-2.1 Ttf1 Ttf-1 Titf1 Thyroid transcription factor 1 Thyroid nuclear factor 1 protein protein rat Rattus norvegicus (Rat) Rat MSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLGAPLAAYRQGQAAPPAAAMQQHAVGHHGAVTAAYHMTAAGVPQLSHSAVGGYCNGNLGNMSELPPYQDTMRNSASGPGWYGANPDPRFPAISRFMGPASGMNMSGMGGLGSLGDVSKNMAPLPSAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQQLQQDSGGGGGGGGGAGCPQQQQAQQQSPRRVAVPVLVKDGKPCQAGAPAPGAASLQGHAQQQAQQQAQAAQAAAAAISVGSGGAGLGAHPGHQPGSAGQSPDLAHHAASPAALQGQVSSLSHLNSSGSDYGAMSCSTLLYGRTW pax8-titf1-2 Interaction between PAX8 and TITF1 demonstrated by GST pulldown 599419 N/A 599422 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 599423 unspecified role unspecified role prey prey c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false 2B pax8-titf1-3 Interaction between PAX8 and TITF1 demonstrated by GST pulldown 599419 N/A 599423 unspecified role unspecified role prey prey rat-pc-cl3 Rat thyroid epithelial cells pc-cl3 Rat thyroid epithelial cells N/A 599422 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false 2A pax8-titf1-4 Interaction between PAX8 and TITF1 demonstrated by GST pulldown 599419 N/A 599423 unspecified role unspecified role prey prey paired region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 N/A 599422 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false 2A and 5 The deletion construct is referenced in the text pax8-titf1-1 Colocalization of PAX8 with TITF1 in rat thyroid cells 599420 N/A 599422 unspecified role unspecified role neutral component neutral component N/A 599423 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 1 Proteins colocalized in numerous interconnected nucleoplasmic domains but neither were present in the nucleoli. pax8-titf1-5 Interaction between PAX8 and TITF1 demonstrated by coimmunoprecipitation 599421 N/A 599422 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) N/A 599423 unspecified role unspecified role prey prey rat-pc-cl3 Rat thyroid epithelial cells pc-cl3 Rat thyroid epithelial cells physical association physical association false false false 2C