IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ fan-2002-1 In vivo interaction between NPR1 and transcription factor TGA2 leads to salicylic acid-mediated gene activation in Arabidopsis. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Fan W., Dong X. xdong@duke.edu; Plant Cell (1040-4651) 2002 Only protein-protein interactions imex curation fan-2002-2 In vivo interaction between NPR1 and transcription factor TGA2 leads to salicylic acid-mediated gene activation in Arabidopsis. in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa tag visualisation tag visualisation Fan W., Dong X. xdong@duke.edu; Plant Cell (1040-4651) 2002 Only protein-protein interactions imex curation npr1_arath Regulatory protein NPR1 SAI1 BTB/POZ domain-containing protein NPR1 NPR1 NIM1 At1g64280 F15H21.6 Nonexpresser of PR genes 1 Non-inducible immunity protein 1 Salicylic acid insensitive 1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDTTIDGFADSYEISSTSFVATDNTDSSIVYLAAEQVLTGPDVSALQLLSNSFESVFDSPDDFYSDAKLVLSDGREVSFHRCVLSARSSFFKSALAAAKKEKDSNNTAAVKLELKEIAKDYEVGFDSVVTVLAYVYSSRVRPPPKGVSECADENCCHVACRPAVDFMLEVLYLAFIFKIPELITLYQRHLLDVVDKVVIEDTLVILKLANICGKACMKLLDRCKEIIVKSNVDMVSLEKSLPEELVKEIIDRRKELGLEVPKVKKHVSNVHKALDSDDIELVKLLLKEDHTNLDDACALHFAVAYCNVKTATDLLKLDLADVNHRNPRGYTVLHVAAMRKEPQLILSLLEKGASASEATLEGRTALMIAKQATMAVECNNIPEQCKHSLKGRLCVEILEQEDKREQIPRDVPPSFAVAADELKMTLLDLENRVALAQRLFPTEAQAAMEIAEMKGTCEFIVTSLEPDRLTGTKRTSPGVKIAPFRILEEHQSRLKALSKTVELGKRFFPRCSAVLDQIMNCEDLTQLACGEDDTAEKRLQKKQRYMEIQETLKKAFSEDNLELGNSSLTDSTSSTSKSTGGKRSNRKLSHRRR tga2_arath Transcription factor TGA2 TGA2 BZIP20 HBP1B At5g06950 MOJ9.12 HBP-1b homolog bZIP transcription factor 20 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADTSPRTDVSTDDDTDHPDLGSEGALVNTAASDSSDRSKGKMDQKTLRRLAQNREAARKSRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFISGTGDQAHSTGGNGALAFDAEHSRWLEEKNKQMNELRSALNAHAGDSELRIIVDGVMAHYEELFRIKSNAAKNDVFHLLSGMWKTPAERCFLWLGGFRSSELLKLLANQLEPMTERQLMGINNLQQTSQQAEDALSQGMESLQQSLADTLSSGTLGSSSSGNVASYMGQMAMAMGKLGTLEGFIRQADNLRLQTLQQMIRVLTTRQSARALLAIHDYFSRLRALSSLWLARPRE as_1-arath-dna As-1 element oligonucleotide dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid in vitro In vitro CTAGCGGAGGACTGTCCTCCG tga2-npr1 Interaction between truncated TGA2 protein and NPR1 protein 664737 N/A 664739 unspecified role unspecified role prey prey P93002:p.Cys150Tyr mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false N/A 664740 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false arath-leaf Arabidopsis thaliana leaf leaf leaf physical association physical association false false false 1, 3C, 3D The authors state "In the SA-treated sample, a noticeable increase in NPR1 was observed in the eluate, indicating that SA either enhances the NPR1-TGA2 interaction or, through an unknown mechanism, makes NPR1 more available for binding to TGA2." 24 hour treatment of 1 mM SA. tga2-as_1 Interaction between truncated TGA2 protein and as-1 oligonucleotide 664738 N/A 664741 unspecified role unspecified role prey prey N/A 664740 unspecified role unspecified role bait bait n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false arath-leaf Arabidopsis thaliana leaf leaf leaf direct interaction direct interaction false false false 1 The oligonucleotide was end radiolabelled with 32P