UniProt UniProt http://www.uniprot.org mackinnon-2002-4 C. elegans PAT-4/ILK functions as an adaptor protein within integrin adhesion complexes. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Mackinnon AC., Qadota H., Norman KR., Moerman DG., Williams BD. bdwillms@uiuc.edu Curr. Biol. (0960-9822) 2002 mackinnon-2002-3 C. elegans PAT-4/ILK functions as an adaptor protein within integrin adhesion complexes. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Mackinnon AC., Qadota H., Norman KR., Moerman DG., Williams BD. bdwillms@uiuc.edu cDNA library Curr. Biol. (0960-9822) 2002 mackinnon-2002-1 C. elegans PAT-4/ILK functions as an adaptor protein within integrin adhesion complexes. caeel-embryo Caenorhabditis elegans embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Mackinnon AC., Qadota H., Norman KR., Moerman DG., Williams BD. bdwillms@uiuc.edu Curr. Biol. (0960-9822) 2002 mackinnon-2002-2 C. elegans PAT-4/ILK functions as an adaptor protein within integrin adhesion complexes. caeel Caenorhabditis elegans fluorescence imaging fluorescence microscopy fluorescence imaging tag visualisation tag visualisation Mackinnon AC., Qadota H., Norman KR., Moerman DG., Williams BD. bdwillms@uiuc.edu Curr. Biol. (0960-9822) 2002 mackinnon-2002-5 C. elegans PAT-4/ILK functions as an adaptor protein within integrin adhesion complexes. in vitro In vitro pull down pull down weight silver stain molecular weight estimation by silver staining weight silver stain Mackinnon AC., Qadota H., Norman KR., Moerman DG., Williams BD. bdwillms@uiuc.edu Curr. Biol. (0960-9822) 2002 ilkh_caeel Integrin-linked protein kinase homolog pat-4 pat-4 Paralyzed and arrested elongation at two-fold protein 4 C29F9.7 protein protein caeel Caenorhabditis elegans MSLSTHYHAHKPNVPIIMEDVFGWVREGNAFQVRVWLDDHEHDLNVGDDHAFSLLHWAAKGGHVAIAEMLLSRGARVNSTNMGDDTSLHLAAAHGHRQIVVKLLSRKADVNATNEHGMTPLHYACFWGYEQIAEDLISCGAAVNVCNKKGMTPLDVCQPMCKNTILEIAQEHGQSPNDRVPFKDTTWKGTKSRTRDATLSRYTGVDVSSLNLITKIAESHSGELWRGKWQGNDIVARILNVQEVTARISRDFQTEFPALRIFAHPNICAVLAAANQPPNLVIISQYMPFGSLYNVLHEQSSVVIDHGQAVRFALDIARGMSYLHSLDPMLLRFYLSSKHVVVDEELTAKLSMADTKFSFQEVGKAYSPAWMSPEALSRAPEDLNIRAADMWSFAILLWELNTREVPFSDLPPMECGMKIALEGLRVHIPPGIARNMNRLMNICMNEDPGRRPNFDQIIPILERMIL un112_caeel Protein unc-112 Uncoordinated protein 112 Mitogen-inducible mig-2 protein-like unc-112 C47E8.7 protein protein caeel Caenorhabditis elegans MAHLVEGTSIIDGKWQLPILVTDLNIQRSISVLGNLNVGGLMLELVSECDVERDWSDHALWWPEKRRWLQHTRSTLDQNGITAETQLEFTPMHKEARIQLPDMQMIDARVDFSVNSFKATKKLCRDLGIRYSEELSLKRYIPPEDLRRGTSDADNMNGPLSMRPGEESVGPMTLRKAAPIFASQSNLDMRRRGQSPALSQSGHIFNAHEMGTLPRHGTLPRGVSPSPGAYNDTMRRTPIMPSISFSEGLENEQFDDALIHSPRLAPSRDTPVFRPQNYVEKAAINRGWLDSSRSLMEQGIFEGDIILLRFKFMNFFDLNPKYDPVRINQLYEQAKWSILLDEFDHTEEEATLFAALQLQATLQRDSPEPEENNKDDVDILLDELEQNLDAAALNRRSDLTQVPELADYLKYMKPKKLAAFKGFKRAFFSFRDLYLSYHQSSSDVNSAPLGHFSLKGCEVSQDVSVGQQKYHIKLLLPTAEGMIDFILKCDSEHQYARWMAACRLASRGKSMADSSYQQEVESIKNLLKMQSGNGNENGNSNTASRKAAAVKLPNDFNVDEYISSKYVRRARSKQQIQQRVSDAHGNVRQLTATEAKLQYIRAWQALPEHGIHYFIVRFRNARKAELVAVAVNRLAKLNMDNGESLKTWRFANMKKWHVNWEIRHLKIQFEDEDIEFKPLSADCKVVHEFIGGYIFLSMRSKEHSQNLDEELFHKLTGGWA unc97_caeel LIM domain-containing protein unc-97 unc-97 F14D12.2 Uncoordinated protein 97 PINCH homolog protein protein caeel Caenorhabditis elegans MDSDHNHINGDLAHGFENMVCVRCNDGFSMQDQMVNSSGQVWHSECFVCAQCFEPFPDGIYFEYEGRKYCEHDFHVLFSPCCGKCNEFIVGRVIKAMNASWHPGCFCCEICNKQLADVGFLRNAGRALCRECNEREKAAGHGRYVCHKCHAMIDDGQHIKFRGDSFHPYHFKCKRCNNELTTASREVNGELYCLRCHDTMGIPICGACHRPIEERVIAALGKHWHVEHFVCSVCEKPFLGHRHYERKGLPYCEQHFHKLFGNLCFKCGDPCCGEVFQALQKTWCVKCFSCSFCDKKLDQKTKFYEFDMKPTCKRCYDRFPTELKKRISESLKDRDVENQRRSMSPGPK pat3_caeel Integrin beta pat-3 pat-3 ZK1058.2 Paralyzed arrest at two-fold protein 3 protein protein caeel Caenorhabditis elegans MPPSTSLLLLAALLPFALPASDWKTGEVTGKVVEKSEFPCYSLSRDNYTCSACIQYHESCAWCGAPMFDEKKPYARCDSRAKLMEHGCPNSYIEDPATKLDITEDSKLSDQGQVESEEEAVQIKPQEMYVEIRPKSRVRFNVTYRQAVDYPVDLYYLMDLSYSMKDDKQKLSELGDLLAERMRTVTKNFRLGFGSFIDKKLMPFIDPRIEKQLSPCPTPCAEPYGFKHQMSLTTNTAKFKAEVDKAEISGNLDAPEGGFDAVVQALACNKTIGWRERARKMIVFSTDAGFHFAGDGRLAGVVEPNDGTCHLDREGYYTETLNQDYPSIALLHQMIKDRKANVIFAVTKNNQDLYTQLSNALPDVSSSVGVLANDSRNIVDLIEKEYLKISEKIIMVDNANASEGLKLTYRSMCLDGTTLKDTNVCEGIRVGDEVQFEVTLENTHCIDKRDFVLRIGPSGLDETLIVNVKVLCDCDCERQDRIVTNSADCNGGDMVCGVCRCKGGNVGKYCECNRPGMSTAALNEKCKRTNESAICEGRGVCNCGRCECNPRANPEEQISGEFCECDNFNCPRHDRKICAEHGECNCGKCICAPGWTGRACECPISTDSCLSANGKICNGKGECICGRCRCFDSPDGNRYSGAKCEICPTCPTKCVEYKNCVMCQQWQTGPLNETACDQCEFKVIPVEELPNLNETTPCQFVDPADDCTFYYLYYYDEATDNATVWVRKHKDCPPPVPVLAIVLGVIAGIVILGILLLLLWKLLTVLHDRSEYATFNNERLMAKWDTNENPIYKQATTTFKNPVYAGKAN unc112-pat4-2 682797 N/A 682802 unspecified role unspecified role prey prey N/A 682803 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig 7A pat4-unc112-1 682797 N/A 682803 unspecified role unspecified role prey prey N/A 682802 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig 7B pat4-unc97-1 682797 N/A 682802 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 682804 unspecified role unspecified role prey prey physical association physical association false false false Fig 7D unc112-pat4-1 682798 N/A 682803 unspecified role unspecified role bait bait N/A 682802 unspecified role unspecified role prey prey physical association physical association false false false unc97-pat4-1 682798 N/A 682802 unspecified role unspecified role prey prey N/A 682804 unspecified role unspecified role bait bait physical association physical association false false false pat4-pat3-1 682799 N/A 682802 unspecified role unspecified role neutral component neutral component c-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 682805 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig 3A-3C pat4-pat3-2 682800 N/A 682802 unspecified role unspecified role neutral component neutral component c-terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 682805 unspecified role unspecified role neutral component neutral component c-terminus cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Fig 3D-3F pat4-unc112-2 682801 N/A 682802 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 682803 unspecified role unspecified role prey prey n-terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig 7C