IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ millband-2002-1 Fission yeast Mad3p is required for Mad2p to inhibit the anaphase-promoting complex and localizes to kinetochores in a Bub1p-, Bub3p-, and Mph1p-dependent manner. schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Millband DN., Hardwick KG. hardwick@holyrood.ed.ac.uk Mol. Cell. Biol. (0270-7306) 2002 Only protein-protein interactions imex curation millband-2002-2 Fission yeast Mad3p is required for Mad2p to inhibit the anaphase-promoting complex and localizes to kinetochores in a Bub1p-, Bub3p-, and Mph1p-dependent manner. schpm Schizosaccharomyces pombe (fission yeast) Fission yeast fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Millband DN., Hardwick KG. hardwick@holyrood.ed.ac.uk Mol. Cell. Biol. (0270-7306) 2002 Only protein-protein interactions imex curation slp1_schpo WD repeat-containing protein slp1 slp1 SPAC821.08c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MEIAGNSSTISPTFSTPTKKRNLVFPNSPITPLHQQALLGRNGRSSKRCSPKSSFIRNSPKIDVVNTDWSIPLCGSPRNKSRPASRSDRFIPSRPNTANAFVNSISSDVPFDYSESVAEACGFDLNTRVLAFKLDAPEAKKPVDLRTQHNRPQRPVVTPAKRRFNTTPERVLDAPGIIDDYYLNLLDWSNLNVVAVALERNVYVWNADSGSVSALAETDESTYVASVKWSHDGSFLSVGLGNGLVDIYDVESQTKLRTMAGHQARVGCLSWNRHVLSSGSRSGAIHHHDVRIANHQIGTLQGHSSEVCGLAWRSDGLQLASGGNDNVVQIWDARSSIPKFTKTNHNAAVKAVAWCPWQSNLLATGGGTMDKQIHFWNAATGARVNTVDAGSQVTSLIWSPHSKEIMSTHGFPDNNLSIWSYSSSGLTKQVDIPAHDTRVLYSALSPDGRILSTAASDENLKFWRVYDGDHVKRPIPITKTPSSSITIR 52E021FD4EECE5DE mad2_schpo Mitotic spindle checkpoint component mad2 mad2 SPBC20F10.06 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSSVPIRTNFSLKGSSKLVSEFFEYAVNSILFQRGIYPAEDFKVVRKYGLNMLVSVDEEVKTYIRKIVSQLHKWMFAKKIQKLILVITSKCSGEDLERWQFNVEMVDTADQFQNIGNKEDELRVQKEIQALIRQITATVTFLPQLEEQCTFNVLVYADKDSEVPTDWVDSDPRILRDAEQVQLRSFSTSMHKIDCQVAYRVNP DC9D1D213450C925 mad3_schpo Mitotic spindle checkpoint component mad3 mad3 SPCC1795.01c SPCC895.02 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MEPLDAGKNWVHMDVIEQSKENIEPRKAGHSASALAKSSSRNHTEKEVAGLQKERMGHERKIETSESLDDPLQVWIDYIKWTLDNFPQGETKTSGLVTLLERCTREFVRNPLYKDDVRYLRIWMQYVNYIDEPVELFSFLAHHHIGQESSIFYEEYANYFESRGLFQKADEVYQKGKRMKAKPFLRFQQKYQQFTHRWLEFAPQSFSSNTNSVNPLQTTFESTNIQEISQSRTKISKPKFKFSVYSDADGSGKDGQPGTWQTLGTVDQRRKENNISATSWVGEKLPLKSPRKLDPLGKFQVHCDEEVSKE EEC3EA6D3790C4BF bub3_schpo Mitotic checkpoint protein bub3 bub3 SPAC23H3.08c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MNFSKTLLKNSKDGISSVIFSPSVKNELIAGCWDGSLLHYQISENPELLGKYDLSSPILSLEYTDEKTALVGNLDGTVTTLDLNTRNHEFLGNHGKGVSCISKLRLENCFISGSWDKSFRVWDVRVKQPVEGQDIGKKIFASSSRDNILVLGCSERENLVYDIRNLKLPFQRRPSSFKYMTRSVCCNQNFEGFVSSSIEGRTSVEYINPSQEAQSKNFTFKCHRQIQKDYDIVYPVNDLKFHPIHQTLATAGGDGVVAFWDIQVRKRLRVLNPSKINISSISFNVDGSMLAIATCAQEEAAGNIYVHALESNFAAPKLKS A5028C58CEBEED43 cenpa_schpo Histone H3-like centromeric protein cnp1 cnp1 sim2 SPBC1105.17 CENP-A homolog Silencing in the middle of the centromere protein 2 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MAKKSLMAEPGDPIPRPRKKRYRPGTTALREIRKYQRSTDLLIQRLPFSRIVREISSEFVANFSTDVGLRWQSTALQCLQEAAEAFLVHLFEDTNLCAIHAKRVTIMQRDMQLARRIRGA slp1-mad3-1 Interaction between Slp1, Mad2 and Mad3 identified by coimmunoprecipitation 653477 N/A 653479 unspecified role unspecified role prey prey N/A 653480 unspecified role unspecified role prey prey N/A 653481 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Cells were checkpoint-arrested. Fig. 4A bub3-mad3-4 Interaction between Bub3 and Mad3 identified by coimmunoprecipitation 653477 N/A 653482 unspecified role unspecified role prey prey N/A 653481 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Cells grown in presence of carbendazim to activate the spindle checkpoint. 4B cnp1-mad3-1 Interaction between Cnp1 and Mad3 identified by colocalisation 653478 N/A 653483 unspecified role unspecified role neutral component neutral component N/A 653481 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false 5B