IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ haracska-2001-1 Interaction with PCNA is essential for yeast DNA polymerase eta function. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by staining molecular weight estimation by staining weight by staining Haracska L., Kondratick CM., Unk I., Prakash S., Prakash L. Proteins purified prior to gel filtration. Complex size determined by molecular weight. lprakash@scms.utmb.edu Mol. Cell (1097-2765) 2001 Only protein-protein interactions imex curation haracska-2001-2 Interaction with PCNA is essential for yeast DNA polymerase eta function. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Haracska L., Kondratick CM., Unk I., Prakash S., Prakash L. lprakash@scms.utmb.edu Mol. Cell (1097-2765) 2001 Only protein-protein interactions imex curation Proteins purified prior to gel filtration. Complex size determined by molecular weight. haracska-2001-3 Interaction with PCNA is essential for yeast DNA polymerase eta function. in vitro In vitro dna dna pol assay dna directed dna polymerase assay dna dna pol assay predetermined predetermined participant predetermined Haracska L., Kondratick CM., Unk I., Prakash S., Prakash L. lprakash@scms.utmb.edu Mol. Cell (1097-2765) 2001 Only protein-protein interactions imex curation Proteins purified prior to gel filtration. Complex size determined by molecular weight. pcna_yeast Proliferating cell nuclear antigen YBR0811 YBR088C POL30 protein protein yeast Saccharomyces cerevisiae Baker's yeast MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGMDLTSLSKILRCGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMDIDADFLKIEELQYDSTLSLPSSEFSKIVRDLSQLSDSINIMITKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFLAPKFNDEE 9B56C5851621DDDC polh_yeast DNA polymerase eta RAD30 DBH1 YDR419W Radiation-sensitive protein 30 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSKFTWKELIQLGSPSKAYESSLACIAHIDMNAFFAQVEQMRCGLSKEDPVVCVQWNSIIAVSYAARKYGISRMDTIQEALKKCSNLIPIHTAVFKKGEDFWQYHDGCGSWVQDPAKQISVEDHKVSLEPYRRESRKALKIFKSACDLVERASIDEVFLDLGRICFNMLMFDNEYELTGDLKLKDALSNIREAFIGGNYDINSHLPLIPEKIKSLKFEGDVFNPEGRDLITDWDDVILALGSQVCKGIRDSIKDILGYTTSCGLSSTKNVCKLASNYKKPDAQTIVKNDCLLDFLDCGKFEITSFWTLGGVLGKELIDVLDLPHENSIKHIRETWPDNAGQLKEFLDAKVKQSDYDRSTSNIDPLKTADLAEKLFKLSRGRYGLPLSSRPVVKSMMSNKNLRGKSCNSIVDCISWLEVFCAELTSRIQDLEQEYNKIVIPRTVSISLKTKSYEVYRKSGPVAYKGINFQSHELLKVGIKFVTDLDIKGKNKSYYPLTKLSMTITNFDIIDLQKTVVDMFGNQVHTFKSSAGKEDEEKTTSSKADEKTPKLECCKYQVTFTDQKALQEHADYHLALKLSEGLNGAEESSKNLSFGEKRLLFSRKRPNSQHTATPQKKQVTSSKNILSFFTRKK CFB1A9FBC8AFE39B m13 Phage M13 genome dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid bpm13 Enterobacteria phage M13 Bacteriophage M13 pcna-7 Homotrimerisation of PCNA detected following gel filtration 593980 N/A 593983 unspecified role unspecified role neutral component neutral component Stoichiometry: 3.0 physical association physical association false false false 2A pcna-rad30-1 Interaction between PCNA and RAD30 detected following gel filtration 593980 N/A 593984 unspecified role unspecified role neutral component neutral component c-terminal region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false Q04049:p.Phe627_Phe628delinsAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast Stoichiometry: 1.0 N/A 593983 unspecified role unspecified role neutral component neutral component yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast Stoichiometry: 3.0 physical association physical association false false false 2A pcna-rad30-2 Interaction between PCNA and RAD30 detected following Y2H 593981 N/A 593983 unspecified role unspecified role bait bait N/A 593984 unspecified role unspecified role prey prey c-terminal region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false Q04049:p.Phe627_Phe628delinsAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false Table 1 pcna-rad30-3 Stimulation of DNA Synthesis Activity of RAD30 by PCNA 593982 N/A 593984 enzyme enzyme unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 593985 enzyme target enzyme target substrate substrate unspecified role unspecified role dna elongation dna strand elongation DNA replication elongation dna elongation false false false 2B By PCNA (P15873), Replication Factor Complex and RPA (P22336) at 150mM NaCl.