IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ luciano-2001-6 Functional reconstitution of the import of the yeast ADP/ATP carrier mediated by the TIM10 complex. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Luciano P., Vial S., Vergnolle MA., Dyall SD., Robinson DR., Tokatlidis K. The two genes were cloned as an operon in the same expression vector and co-expressed in E.coli. tokatlidis@man.ac.uk EMBO J. (0261-4189) 2001 luciano-2001-1 Functional reconstitution of the import of the yeast ADP/ATP carrier mediated by the TIM10 complex. ecoli Escherichia coli (strain K12) pull down pull down western blot western blot Immuno blot Immuno blot Luciano P., Vial S., Vergnolle MA., Dyall SD., Robinson DR., Tokatlidis K. The two genes were cloned as an operon in the same expression vector and co-expressed in E.coli. tokatlidis@man.ac.uk EMBO J. (0261-4189) 2001 luciano-2001-2 Functional reconstitution of the import of the yeast ADP/ATP carrier mediated by the TIM10 complex. ecoli Escherichia coli (strain K12) molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Luciano P., Vial S., Vergnolle MA., Dyall SD., Robinson DR., Tokatlidis K. The two genes were cloned as an operon in the same expression vector and co-expressed in E.coli. tokatlidis@man.ac.uk EMBO J. (0261-4189) 2001 luciano-2001-3 Functional reconstitution of the import of the yeast ADP/ATP carrier mediated by the TIM10 complex. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Luciano P., Vial S., Vergnolle MA., Dyall SD., Robinson DR., Tokatlidis K. The two genes were cloned as an operon in the same expression vector and co-expressed in E.coli. tokatlidis@man.ac.uk EMBO J. (0261-4189) 2001 luciano-2001-4 Functional reconstitution of the import of the yeast ADP/ATP carrier mediated by the TIM10 complex. ecoli Escherichia coli (strain K12) bn-page blue native page bn-page western blot western blot Immuno blot Immuno blot Luciano P., Vial S., Vergnolle MA., Dyall SD., Robinson DR., Tokatlidis K. The two genes were cloned as an operon in the same expression vector and co-expressed in E.coli. tokatlidis@man.ac.uk EMBO J. (0261-4189) 2001 luciano-2001-5 Functional reconstitution of the import of the yeast ADP/ATP carrier mediated by the TIM10 complex. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast bn-page blue native page bn-page western blot western blot Immuno blot Immuno blot Luciano P., Vial S., Vergnolle MA., Dyall SD., Robinson DR., Tokatlidis K. The two genes were cloned as an operon in the same expression vector and co-expressed in E.coli. tokatlidis@man.ac.uk EMBO J. (0261-4189) 2001 tim9_yeast Mitochondrial import inner membrane translocase subunit TIM9 YEL020BW YEL020W-A TIM9 protein protein yeast Saccharomyces cerevisiae Baker's yeast MDALNSKEQQEFQKVVEQKQMKDFMRLYSNLVERCFTDCVNDFTTSKLTNKEQTCIMKCSEKFLKHSERVGQRFQEQNAALGQGLGR tim10_yeast Mitochondrial import inner membrane translocase subunit TIM10 MRS11 YHR005BC YHR005C-A TIM10 Mitochondrial intermembrane protein MRS11 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSFLGFGGGQPQLSSQQKIQAAEAELDLVTDMFNKLVNNCYKKCINTSYSEGELNKNESSCLDRCVAKYFETNVQVGENMQKMGQSFNAAGKF 70DD4764B944FF17 tim9-tim10-6 Interaction between Tim9 and Tim10 demonstrated by coimmunoprecipitation 592705 N/A 592711 unspecified role unspecified role prey prey N/A 592712 unspecified role unspecified role bait bait ecobb Escherichia coli (strain B / BL21) physical association physical association false false false 3 tim9-tim10-7 Interaction between Tim9 and Tim10 demonstrated by coimmunoprecipitation 592705 N/A 592712 unspecified role unspecified role prey prey ecobb Escherichia coli (strain B / BL21) N/A 592711 unspecified role unspecified role bait bait physical association physical association false false false 3 tim9-tim10-1 Interaction between Tim9 and Tim10 demonstrated by GST pulldown 592706 N/A 592712 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 592711 unspecified role unspecified role prey prey physical association physical association false false false 1A Both proteins concomitantly released from the gluathione following cleavage of the GST tag. tim9-tim10-2 Interaction between Tim9 and Tim10 demonstrated by gel filtration 592707 N/A 592712 unspecified role unspecified role neutral component neutral component N/A 592711 unspecified role unspecified role neutral component neutral component physical association physical association false false false 1B tim9-tim10-3 Interaction between Tim9 and Tim10 demonstrated by gel filtration 592708 N/A 592711 unspecified role unspecified role neutral component neutral component N/A 592712 unspecified role unspecified role neutral component neutral component physical association physical association false false false 1B tim9-tim10-4 Interaction between Tim9 and Tim10 demonstrated by BN-PAGE 592709 N/A 592711 unspecified role unspecified role neutral component neutral component N/A 592712 unspecified role unspecified role neutral component neutral component physical association physical association false false false 1C tim9-tim10-5 Interaction between Tim9 and Tim10 demonstrated by BN-PAGE 592710 N/A 592712 unspecified role unspecified role neutral component neutral component N/A 592711 unspecified role unspecified role neutral component neutral component physical association physical association false false false 1C