UniProt UniProt http://www.uniprot.org yang-2001-1 BR22, a novel protein, interacts with thyroid transcription factor-1 and activates the human surfactant protein B promoter. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Yang YS., Yang MC., Wang B., Weissler JC. Yih-Shing.Yang@UTSouthwestern.edu. human adult lung cDNA library Am. J. Respir. Cell Mol. Biol. (1044-1549) 2001 Only protein-protein interactions imex curation yang-2001-2 BR22, a novel protein, interacts with thyroid transcription factor-1 and activates the human surfactant protein B promoter. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Yang YS., Yang MC., Wang B., Weissler JC. Yih-Shing.Yang@UTSouthwestern.edu. human adult lung cDNA library Am. J. Respir. Cell Mol. Biol. (1044-1549) 2001 Only protein-protein interactions imex curation yang-2001-3 BR22, a novel protein, interacts with thyroid transcription factor-1 and activates the human surfactant protein B promoter. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Yang YS., Yang MC., Wang B., Weissler JC. In vitro translated ER-CCDC59/BR22 was incubated with magnetic beads containing anti-HA antibody to the HA-tag of ER-BR22. Yih-Shing.Yang@UTSouthwestern.edu. human adult lung cDNA library Am. J. Respir. Cell Mol. Biol. (1044-1549) 2001 Only protein-protein interactions imex curation yang-2001-4 BR22, a novel protein, interacts with thyroid transcription factor-1 and activates the human surfactant protein B promoter. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Yang YS., Yang MC., Wang B., Weissler JC. Yih-Shing.Yang@UTSouthwestern.edu. human adult lung cDNA library Am. J. Respir. Cell Mol. Biol. (1044-1549) 2001 Only protein-protein interactions imex curation yang-2001-5 BR22, a novel protein, interacts with thyroid transcription factor-1 and activates the human surfactant protein B promoter. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 1 hybrid one hybrid yeast one-hybrid yeast one hybrid one-hybrid 1 hybrid yeast one-hybrid one-hybrid yeast one hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Yang YS., Yang MC., Wang B., Weissler JC. Yih-Shing.Yang@UTSouthwestern.edu. human adult lung cDNA library Am. J. Respir. Cell Mol. Biol. (1044-1549) 2001 Only protein-protein interactions imex curation nkx21_human Homeobox protein Nkx-2.1 NKX2-1 TITF1 NKX2A TTF1 Homeobox protein NK-2 homolog A Thyroid transcription factor 1 Thyroid nuclear factor 1 Thyroid-specific enhancer-binding protein protein protein human Homo sapiens Human MSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLGAPLAAYRQGQAAPPTAAMQQHAVGHHGAVTAAYHMTAAGVPQLSHSAVGGYCNGNLGNMSELPPYQDTMRNSASGPGWYGANPDPRFPAISRFMGPASGMNMSGMGGLGSLGDVSKNMAPLPSAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQQLQQDSGGGGGGGGTGCPQQQQAQQQSPRRVAVPVLVKDGKPCQAGAPAPGAASLQGHAQQQAQHQAQAAQAAAAAISVGSGGAGLGAHPGHQPGSAGQSPDLAHHAASPAALQGQVSSLSHLNSSGSDYGTMSCSTLLYGRTW tap26_human Thyroid transcription factor 1-associated protein 26 TTF-1-associated protein BR2 Coiled-coil domain-containing protein 59 CCDC59 BR22 TAP26 HSPC128 protein protein human Homo sapiens Human MAPVRRSAKWRPGGIEARGEGVSTVGYRNKNVRQKTWRPNHPQAFVGSVREGQGFAFRRKLKIQQSYKKLLRKEKKAQTSLESQFTDRYPDNLKHLYLAEEERHRKQARKVDHPLSEQVHQPLLEEQCSIDEPLFEDQCSFDQPQPEEQCIKTVNSFTIPKKNKKKTSNQKAQEEYEQIQAKRAAKKQEFERRKQEREEAQRQYKKKKMEVFKILNKKTKKGQPNLNVQMEYLLQKIQEKC sp-b_human_promoter SP-B promoter fragment dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid chemical synthesis Chemical synthesis (Chemical synthesis) GATCAAGCACCTGGAGGGCTCTTCAGAGCAAAGACAAACACTGAGGTCGCTGCCA The promoter element contains the TTF-1 and HNF-3 binding sites. An element 7 nucleotides shorter at the 5' end was also used and integrated in the reverse orientation into the HIS3 reporter gene. titf1-ccdc59-1 664201 N/A 664206 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 664207 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false 4C ccdc59-titf1-1 664202 N/A 664206 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 664207 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false 6B ccdc59-titf1-2 664203 N/A 664206 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 664207 unspecified role unspecified role bait bait region estrogen receptor ER fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false 6C ccdc59-titf1-3 664204 N/A 664206 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. N/A 664207 unspecified role unspecified role bait bait region estrogen receptor ER fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false 7 ccdc59-dna-1 664205 N/A 664208 unspecified role unspecified role bait bait N/A 664207 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false no figure