UniProt UniProt http://www.uniprot.org luitjens-2000-1 CPEB proteins control two key steps in spermatogenesis in C. elegans. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Luitjens C., Gallegos M., Kraemer B., Kimble J., Wickens M. wickens@biochem.wisc.edu Genes Dev. (0890-9369) 2000 Only protein-protein interactions imex curation luitjens-2000-2 CPEB proteins control two key steps in spermatogenesis in C. elegans. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Luitjens C., Gallegos M., Kraemer B., Kimble J., Wickens M. wickens@biochem.wisc.edu LambdaAct-RB-2library was used. Genes Dev. (0890-9369) 2000 Only protein-protein interactions imex curation luitjens-2000-3 CPEB proteins control two key steps in spermatogenesis in C. elegans. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Luitjens C., Gallegos M., Kraemer B., Kimble J., Wickens M. wickens@biochem.wisc.edu Genes Dev. (0890-9369) 2000 Only protein-protein interactions imex curation fbf1_caeel Fem-3 mRNA-binding factor 1 fbf-1 H12I13.4 protein protein caeel Caenorhabditis elegans MDQSKMRYTNQFRKTPQKPTSTEVGNHHTPAHSPMAQHETSMWNFNSLNPYFSMLNMNDGMNYARHQQNHIVTSRPPTPLTDLMSLRSFQSFPNVFMPVSRSRTSSFIQSDTDSSRLEPDDFSQNVRYCSTEIDRNNSSSKNDHLKYSRPALSRNSRSFTRSNNVLPTWSLDSNGEMRSRLSLSEVLDSGDLMKFAVDKTGCQFLEKAVKGSLTSYQKFQLFEQVIGRKDDFLKLSTNIFGNYFVQEIIGMSLTTYDDDNIKRQEKLKNFISSQMTDMCLDKFACRVIQSSLQNMDLSLACKLVQALPRDARLIAICVDQNANHVIQKVVAVIPLKNWEFIVDFVATPEHLRQICFDKYGCRVVQTIIEKLTADSINVDLTSAAQHLRERALQRLMTSVTNRCQELATNEYANYIIQHIVSNDDLAVYRECIIEKCLMRNLLSLSQEKFASHVVEKAFLHAPMELLAEMMDEIFDGYMPHPGTGKDALDIMMFHQFGNYVVQCMLTICCDAVSGRRQTKEGSYDHANSFQVWLKKLHSRVTKERHRLSRFSSGKKMIETLAHLRSTHPIYGLQSSGHESFKTDCFSTASEHDGLELEKNGIEEGNLRLMRTFSP cpb1_caeel Cytoplasmic polyadenylation element-binding protein 1 cpb-1 C40H1.1 protein protein caeel Caenorhabditis elegans MQYQLSPSGDFKTSAPVRSSHGHRRSTESKKSGGHGNPYLSTDKTNLDISVSFLTSQAQKKMRGMSANHGIFDPTEMLTADDPSNYGYQFLNHATFYNNMDIMQAASGDVPPLMSVNPYKQSFDINDASAAMNMAQFAHTLNAIQNSSYSMSHYNQAPMQHFISPNSFHVSYNQRFPHIKKNATHANRMVEIKKINGHRYMEVTDPQAVSAPPEYKRLDGSLMGVSKSCLEASKKRPISAEPLYSRKVFIGGLPIDVSEEQVWATFGAFGKVLIDWPRRPEHNAERAEQELKKGSGSRAVTGYVFLVFTHERSVQELVNACEFYEDKYYLQLSSPTMTDKAVQVRPWRLSDIDYFCNDNSSVDHRRTVFIGGVPRPTRAQDLARCLEGHYGKVSYVGIDIDPELKYPKGAARVTFSTSQAFVRAISGRFVQVNHAENNKRVEIKPYVMEEQYCDECEGRLCKHNYAPYFCGHASCLQYYCEGCWDRMHIGKNEDNKLEDQHYPMVRTGDQTRLLKHLPHRSSGFKPAPVFHPSSQSTTAKILAYGDQSQRQFSATPSYSF cpb1-fbf1-1 684393 N/A 684396 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 684397 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig 6A, 6B fbf1-cpb1-1 684393 N/A 684396 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 684397 unspecified role unspecified role prey prey physical association physical association false false false Fig 6A cpb1-fbf1-2 684394 N/A 684396 unspecified role unspecified role prey prey N/A 684397 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false fbf1-cpb1-2 684394 N/A 684396 unspecified role unspecified role bait bait N/A 684397 unspecified role unspecified role prey prey physical association physical association false false false fbf1-cpb1-3 684395 N/A 684396 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 684397 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false 6C, 6D