UniProt UniProt http://www.uniprot.org mcnew-1998-1 Gos1p, a Saccharomyces cerevisiae SNARE protein involved in Golgi transport. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot McNew JA., Coe JG., Sogaard M., Zemelman BV., Wimmer C., Hong W., Sollner TH. GOS1 was expressed in E. coli as a fusion protein with GST before being cleaved by thrombin to be available as a free protein. j-mc-new@ski.mskcc.org FEBS Lett. (0014-5793) 1998 Only protein-protein interactions imex curation mcnew-1998-2 Gos1p, a Saccharomyces cerevisiae SNARE protein involved in Golgi transport. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot McNew JA., Coe JG., Sogaard M., Zemelman BV., Wimmer C., Hong W., Sollner TH. GOS1 was expressed in E. coli as a fusion protein with GST before being cleaved by thrombin to be available as a free protein. j-mc-new@ski.mskcc.org FEBS Lett. (0014-5793) 1998 Only protein-protein interactions imex curation gosr1_yeast Golgi SNAP receptor complex member 1 Golgi SNARE protein 1 GOS1 Protein transport protein GOS1 YHL031C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSQPSFVTIRGKAISLETQTESLLSKYSTFAQTTSSEQTGQEKKIDKQLEGILGQRQDVIDSLTQICDSNPAISASKLSQLHRHKEILQDHWKSFRNIRSSIQQERNRLNLLFSVKNDIANSTTDAPAPIGDADEYIQNETRRIDQSNNVVDRLISQAWETRSQFHSQSNVLNTANNKVLQTLQRIPGVNQLIMKINTRRKKNAFVLATITTLCILFLFFTW sec17_yeast Alpha-soluble NSF attachment protein SEC17 alpha-SNAP chaperone N-ethylmaleimide-sensitive factor attachment protein alpha Vesicular-fusion protein SEC17 YBL0505 YBL0517 YBL050W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSDPVELLKRAEKKGVPSSGFMKLFSGSDSYKFEEAADLCVQAATIYRLRKELNLAGDSFLKAADYQKKAGNEDEAGNTYVEAYKCFKSGGNSVNAVDSLENAIQIFTHRGQFRRGANFKFELGEILENDLHDYAKAIDCYELAGEWYAQDQSVALSNKCFIKCADLKALDGQYIEASDIYSKLIKSSMGNRLSQWSLKDYFLKKGLCQLAATDAVAAARTLQEGQSEDPNFADSRESNFLKSLIDAVNEGDSEQLSEHCKEFDNFMRLDKWKITILNKIKESIQQQEDDLL 5002D31F80A65319 sec22_yeast Protein transport protein SEC22 SEC22 SLY2 YLR268W L8479.3 TSL26 Suppressor of loss of YPT1 protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MIKSTLIYREDGLPLCTSVDNENDPSLFEQKQKVKIVVSRLTPQSATEATLESGSFEIHYLKKSMVYYFVICESGYPRNLAFSYLNDIAQEFEHSFANEYPKPTVRPYQFVNFDNFLQMTKKSYSDKKVQDNLDQLNQELVGVKQIMSKNIEDLLYRGDSLDKMSDMSSSLKETSKRYRKSAQKINFDLLISQYAPIVIVAFFFVFLFWWIFLK 9FA3E34EAAFB9536 sed5_yeast Integral membrane protein SED5 SED5 YLR026C protein protein yeast Saccharomyces cerevisiae Baker's yeast MNIKDRTSEFQQSVLSYKKRNKNFREQQRERLQEKESENFANNTTGNGKSVSEFQKKASGIAHEISSTAQLLSKLAVLAKRKPMFNDNPVEIAELSFLIKRKIYAIEQSLVQLSQLKKTDVNGNTSNQSSKQPSAVQHSKNVVNLLNTQMKNISGSFKDVLEERQRLEMANKDRWQKLTTDTGHAPADDQTQSNHAADLTTYNNSNPFMTSLLDESSEKNNNSSNQGELSFPQNDSQLMLMEEGQLSNNVYLQERNRAVETIESTIQEVGNLFQQLASMVQEQGEVIQRIDANVDDIDLNISGAQRELLKYFDRIKSNRWLAAKVFFIIFVFFVIWVLVN B3192B57269A0B83 sec17-sec17 501850 N/A 501852 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 501853 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false 1A sec17-sec22 501850 N/A 501854 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 501853 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false 1A sed5-gos1 501851 N/A 501852 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) N/A 501855 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false 1B