IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ choi-1994-1 Ste5 tethers multiple protein kinases in the MAP kinase cascade required for mating in S. cerevisiae. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Choi KY., Satterberg B., Lyons DM., Elion EA. Table 1, Figure 1 Cell (0092-8674) 1994 Only protein-protein interactions imex curation choi-1994-2 Ste5 tethers multiple protein kinases in the MAP kinase cascade required for mating in S. cerevisiae. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down western blot western blot Immuno blot Immuno blot Choi KY., Satterberg B., Lyons DM., Elion EA. Table 1, Figure 1 Cell (0092-8674) 1994 Only protein-protein interactions imex curation choi-1994-3 Ste5 tethers multiple protein kinases in the MAP kinase cascade required for mating in S. cerevisiae. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Choi KY., Satterberg B., Lyons DM., Elion EA. 10-30% glycerol gradient Table 1, Figure 1 Cell (0092-8674) 1994 Only protein-protein interactions imex curation ste7_yeast Serine/threonine-protein kinase STE7 STE7 D1525 YDL159W protein protein yeast Saccharomyces cerevisiae Baker's yeast MFQRKTLQRRNLKGLNLNLHPDVGNNGQLQEKTETHQGQSRIEGHVMSNINAIQNNSNLFLRRGIKKKLTLDAFGDDQAISKPNTVVIQQPQNEPVLVLSSLSQSPCVSSSSSLSTPCIIDAYSNNFGLSPSSTNSTPSTIQGLSNIATPVENEHSISLPPLEESLSPAAADLKDTLSGTSNGNYIQLQDLVQLGKIGAGNSGTVVKALHVPDSKIVAKKTIPVEQNNSTIINQLVRELSIVKNVKPHENIITFYGAYYNQHINNEIIILMEYSDCGSLDKILSVYKRFVQRGTVSSKKTWFNELTISKIAYGVLNGLDHLYRQYKIIHRDIKPSNVLINSKGQIKLCDFGVSKKLINSIADTFVGTSTYMSPERIQGNVYSIKGDVWSLGLMIIELVTGEFPLGGHNDTPDGILDLLQRIVNEPSPRLPKDRIYSKEMTDFVNRCCIKNERERSSIHELLHHDLIMKYVSPSKDDKFRHWCRKIKSKIKEDKRIKREALDRAKLEKKQSERSTH C8A75899CFBE8BDE ste5_yeast Protein STE5 STE5 NUL3 YDR103W YD8557.12 protein protein yeast Saccharomyces cerevisiae Baker's yeast MMETPTDNIVSPFHNFGSSTQYSGTLSRTPNQIIELEKPSTLSPLSRGKKWTEKLARFQRSSAKKKRFSPSPISSSTFSFSPKSRVTSSNSSGNEDGNLMNTPSTVSTDYLPQHPHRTSSLPRPNSNLFHASNSNLSRANEPPRAENLSDNIPPKVAPFGYPIQRTSIKKSFLNASCTLCDEPISNRRKGEKIIELACGHLSHQECLIISFGTTSKADVRALFPFCTKCKKDTNKAVQCIPENDELKDILISDFLIHKIPDSELSITPQSRFPPYSPLLPPFGLSYTPVERQTIYSQAPSLNPNLILAAPPKERNQIPQKKSNYTFLHSPLGHRRIPSGANSILADTSVALSANDSISAVSNSVRAKDDETKTTLPLLRSYFIQILLNNFQEELQDWRIDGDYGLLRLVDKLMISKDGQRYIQCWCFLFEDAFVIAEVDNDVDVLEIRLKNLEVFTPIANLRMTTLEASVLKCTLNKQHCADLSDLYIVQNINSDESTTVQKWISGILNQDFVFNEDNITSTLPILPIIKNFSKDVGNGRHETSTFLGLINPNKVVEVGNVHDNDTVIIRRGFTLNSGECSRQSTVDSIQSVLTTISSILSLKREKPDNLAIILQIDFTKLKEEDSLIVVYNSLKALTIKFARLQFCFVDRNNYVLDYGSVLHKIDSLDSISNLKSKSSSTQFSPIWLKNTLYPENIHEHLGIVAVSNSNMEAKKSILFQDYRCFTSFGRRRPNELKIKVGYLNVDYSDKIDELVEASSWTFVLETLCYSFGLSFDEHDDDDEEDNDDSTDNELDNSSGSLSDAESTTTIHIDSPFDNENATANMVNDRNLLTEGEHSNIENLETVASSVQPALIPNIRFSLHSEEEGTNENENENDMPVLLLSDMDKGIDGITRRSSFSSLIESGNNNCPLHMDYI 0435BDA0196B2D6F ste11_yeast Serine/threonine-protein kinase STE11 STE11 L8039.10 YLR362W protein protein yeast Saccharomyces cerevisiae Baker's yeast MEQTQTAEGTDLLIGDEKTNDLPFVQLFLEEIGCTQYLDSFIQCNLVTEEEIKYLDKDILIALGVNKIGDRLKILRKSKSFQRDKRIEQVNRLKNLMEKVSSLSTATLSMNSELIPEKHCVIFILNDGSAKKVNVNGCFNADSIKKRLIRRLPHELLATNSNGEVTKMVQDYDVFVLDYTKNVLHLLYDVELVTICHANDRVEKNRLIFVSKDQTPSDKAISTSKKLYLRTLSALSQVGPSSSNLLAQNKGISHNNAEGKLRIDNTEKDRIRQIFNQRPPSEFISTNLAGYFPHTDMKRLQKTMRESFRHSARLSIAQRRPLSAESNNIGDILLKHSNAVDMALLQGLDQTRLSSKLDTTKIPKLAHKRPEDNDAISNQLELLSVESGEEEDHDFFGEDSDIVSLPTKIATPKNWLKGACIGSGSFGSVYLGMNAHTGELMAVKQVEIKNNNIGVPTDNNKQANSDENNEQEEQQEKIEDVGAVSHPKTNQNIHRKMVDALQHEMNLLKELHHENIVTYYGASQEGGNLNIFLEYVPGGSVSSMLNNYGPFEESLITNFTRQILIGVAYLHKKNIIHRDIKGANILIDIKGCVKITDFGISKKLSPLNKKQNKRASLQGSVFWMSPEVVKQTATTAKADIWSTGCVVIEMFTGKHPFPDFSQMQAIFKIGTNTTPEIPSWATSEGKNFLRKAFELDYQYRPSALELLQHPWLDAHII E9E0DF27114EEEEF fus3_yeast Mitogen-activated protein kinase FUS3 FUS3 DAC2 YBL016W YBL0303 YBL03.21 protein protein yeast Saccharomyces cerevisiae Baker's yeast MPKRIVYNISSDFQLKSLLGEGAYGVVCSATHKPTGEIVAIKKIEPFDKPLFALRTLREIKILKHFKHENIITIFNIQRPDSFENFNEVYIIQELMQTDLHRVISTQMLSDDHIQYFIYQTLRAVKVLHGSNVIHRDLKPSNLLINSNCDLKVCDFGLARIIDESAADNSEPTGQQSGMTEYVATRWYRAPEVMLTSAKYSRAMDVWSCGCILAELFLRRPIFPGRDYRHQLLLIFGIIGTPHSDNDLRCIESPRAREYIKSLPMYPAAPLEKMFPRVNPKGIDLLQRMLVFDPAKRITAKEALEHPYLQTYHDPNDEPEGEPIPPSFFEFDHYKEALTTKDLKKLIWNEIFS 5117980D20A1E7E2 kss1_yeast Mitogen-activated protein kinase KSS1 KSS1 Kinase suppressor of SST2 YGR040W protein protein yeast Saccharomyces cerevisiae Baker's yeast MARTITFDIPSQYKLVDLIGEGAYGTVCSAIHKPSGIKVAIKKIQPFSKKLFVTRTIREIKLLRYFHEHENIISILDKVRPVSIDKLNAVYLVEELMETDLQKVINNQNSGFSTLSDDHVQYFTYQILRALKSIHSAQVIHRDIKPSNLLLNSNCDLKVCDFGLARCLASSSDSRETLVGFMTEYVATRWYRAPEIMLTFQEYTTAMDIWSCGCILAEMVSGKPLFPGRDYHHQLWLILEVLGTPSFEDFNQIKSKRAKEYIANLPMRPPLPWETVWSKTDLNPDMIDLLDKMLQFNPDKRISAAEALRHPYLAMYHDPSDEPEYPPLNLDDEFWKLDNKIMRPEEEEEVPIEMLKDMLYDELMKTME 5FA42161B5FD51B5 ste5-ste7-3 Interation between Ste5 and Ste7 identified by Y2H 357514 N/A 357517 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 357518 unspecified role unspecified role bait bait physical association physical association false false false ste5-ste11-2 Interation between Ste5 and Ste11 identified by Y2H 357514 N/A 357519 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 357518 unspecified role unspecified role bait bait physical association physical association false false false ste5-fus3-2 Interation between Ste5 and Fus3 identified by Y2H 357514 N/A 357518 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 357520 unspecified role unspecified role prey prey physical association physical association false false false ste5-kss1-1 Interation between Ste5 and KSS1 identified by Y2H 357514 N/A 357521 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 357518 unspecified role unspecified role bait bait physical association physical association false false false ste7-fus3-5 Interation between Fus3 and Ste7 identified by Y2H 357514 N/A 357517 unspecified role unspecified role bait bait N/A 357520 unspecified role unspecified role prey prey physical association physical association false false false ste7-kss1-5 Interation between Kss1 and Ste7 identified by Y2H 357514 N/A 357521 unspecified role unspecified role prey prey N/A 357517 unspecified role unspecified role bait bait physical association physical association false false false ste7-fus3-6 Interation between Fus3 and Ste11 identified by Y2H 357514 N/A 357520 unspecified role unspecified role prey prey N/A 357519 unspecified role unspecified role bait bait physical association physical association false false false ste11-kss1-3 Interation between KSS1 and Ste11 identified by Y2H 357514 N/A 357521 unspecified role unspecified role prey prey N/A 357519 unspecified role unspecified role bait bait physical association physical association false false false ste11-ste11-3 Interation between Ste11 and Ste11 identified by Y2H 357514 N/A 357519 unspecified role unspecified role bait bait N/A 357519 unspecified role unspecified role prey prey physical association physical association false false false ste5-ste11-3 Interation between Ste5 and Ste11 identified by Y2H 357514 N/A 357518 unspecified role unspecified role prey prey N/A 357519 unspecified role unspecified role bait bait physical association physical association false false false ste11-fus3-1 Interation between Fus3 and Ste11 identified by Y2H 357514 N/A 357519 unspecified role unspecified role bait bait N/A 357520 unspecified role unspecified role prey prey physical association physical association false false false ste11-kss1-4 Interation between Kss1 and Ste11 identified by Y2H 357514 N/A 357519 unspecified role unspecified role bait bait N/A 357521 unspecified role unspecified role prey prey physical association physical association false false false ste5-ste7-4 Interation between Ste5 and Ste7 identified by Y2H 357514 N/A 357518 unspecified role unspecified role bait bait N/A 357517 unspecified role unspecified role prey prey physical association physical association false false false ste7-fus3-7 Interation between Fus3 and Ste7 identified by Y2H 357514 N/A 357517 unspecified role unspecified role bait bait N/A 357520 unspecified role unspecified role prey prey physical association physical association false false false ste7-kss1-6 Interation between KSS1 and Ste7 identified by Y2H 357514 N/A 357517 unspecified role unspecified role bait bait N/A 357521 unspecified role unspecified role prey prey physical association physical association false false false ste5-ste7-5 Interaction between Ste5 and Ste7 identified by Y2H 357514 N/A 357518 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 357517 unspecified role unspecified role prey prey physical association physical association false false false ste5-ste11-4 Interaction between Ste5, Ste11 and Fus3 identified by coimmunoprecipitation 357515 N/A 357520 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 357519 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 357518 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false ste5-fus3-3 Interaction between Ste5 and Fus3 identified by coimmunoprecipitation 357515 N/A 357520 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 357518 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false ste5-ste11-5 Interaction between Ste5 and Ste11 identified by coimmunoprecipitation 357515 N/A 357518 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 357519 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Kinase activity of Ste11 not required for this interaction ste5-ste7-6 Interaction between Ste5 and Ste7 identified by coimmunoprecipitation 357515 N/A 357518 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 357517 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Ste5 associates primarily with an underphosphorylated form of Ste7 ste5-ste7-7 Interaction between Ste5, Ste11 and Ste7 identified by coimmunoprecipitation 357515 N/A 357517 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 357519 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 357518 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false association association false false false Ste5 associates primarily with an underphosphorylated form of Ste7, greater levels of Ste7 associate with Ste5 in the presence of kinase-dead Ste11 ste5-ste11-6 Interaction between Ste5, Ste7, Ste11 and Fus3 identified by cosedimentation 357516 N/A 357518 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 357517 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 357520 unspecified role unspecified role neutral component neutral component N/A 357519 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false